NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29025.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29025.1 Public Mus musculus 17 Lhcgr 16 104 75 CCDS HistoryNCBI Gene:16867Re-query CCDS DB by CCDS ID:29025.1Re-query CCDS DB by GeneID:16867

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29025.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024916 ENSMUSP00000024916 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024916Link to Ensembl Protein Viewer:ENSMUSP00000024916Re-query CCDS DB by Nucleotide ID:ENSMUST00000024916Re-query CCDS DB by Protein ID:ENSMUSP00000024916
Original member Current member NCBI NM_013582.2 NP_038610.1 Accepted alive Link to Nucleotide Sequence:NM_013582.2Link to Protein Sequence:NP_038610.1Re-query CCDS DB by Nucleotide ID:NM_013582Re-query CCDS DB by Protein ID:NP_038610Link to BLink:NP_038610.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038610.1 700 P30730 700 100% 0 0

Chromosomal Locations for CCDS 29025.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

Chromosome Start Stop Links
17 88741994 88743137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88750103 88750183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88753744 88753929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88755551 88755625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88758343 88758411 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88764982 88765059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88765148 88765222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88767253 88767327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88769837 88769911 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88772012 88772083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 88791799 88791971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2103 nt):
ATGGGGCGGCGGGTCCCGGCTCTGAGACAGCTGCTGGTGCTGGCAATGCTGGTGCTGAAGCAGTCACAGC
TG
CACTCTCCAGAGTTGTCAGGGTCGCGCTGCCCTGAGCCCTGCGACTGCGCGCCGGATGGTGCCCTGCG
C
TGCCCTGGCCCTCGAGCTGGCCTCGCCCGACTATCTCTCACCTATCTCCCTGTCAAAGTAATCCCATCA
CAA
GCTTTCAGGGGACTTAATGAGGTCGTAAAAATTGAAATCTCTCAGAGTGATTCCCTGGAAAGGATAG
AA
GCTAATGCCTTTGACAACCTCCTCAATCTGTCTGAAATACTGATCCAGAACACCAAAAACCTGCTATA
C
ATTGAACCCGGTGCTTTTACAAACCTCCCTCGGTTAAAATACCTGAGCATCTGTAACACAGGCATCCGG
ACC
CTCCCAGATGTTTCGAAGATCTCTTCCTCTGAATTTAATTTCATTCTGGAAATCTGTGATAACTTAT
AC
ATAACCACCATACCAGGGAACGCTTTCCAAGGGATGAATAATGAGTCCATCACGCTGAAACTGTATGG
A
AATGGGTTTGAAGAAGTACAAAGCCATGCATTCAATGGGACGACGCTAATCTCGCTGGAGTTAAAAGAA
AAC
ATCTACCTGGAGAAGATGCACAGTGGCACCTTCCAGGGGGCCACGGGGCCCAGCATCCTGGATGTCT
CT
TCCACCAAATTGCAGGCCCTGCCGAGCCACGGGCTGGAGTCCATTCAGACGCTCATCGCCACGTCATC
C
TACTCACTGAAAACTCTGCCCTCCAGAGAAAAATTCACCAGCCTACTGGTTGCCACGCTGACCTACCCT
AGC
CACTGCTGTGCTTTCAGGAATTTGCCGAAGAAAGAACAGAATTTTTCATTTTCCATTTTTGAAAACT
TT
TCCAAACAATGTGAAAGCACAGTTAGAGAAGCGAATAACGAGACGCTTTATTCTGCCATCTTTGAGGA
G
AATGAACTCAGTGGCTGGGATTACGATTATGACTTCTGTTCACCCAAGACACTCCAATGTACTCCAGAA
CCA
GATGCTTTCAATCCCTGTGAAGATATTATGGGCTATGCCTTCCTTAGGGTGTTGATTTGGCTAATTA
AT
ATACTAGCCATCTTTGGCAACTTGACAGTCCTCTTTGTTCTCCTGACCAGTCGTTATAAACTGACGGT
G
CCCCGCTTCCTCATGTGTAATCTCTCCTTTGCAGACTTTTGCATGGGGCTCTACCTGCTGCTCATTGCC
TCA
GTAGACTCCCAAACAAAAGGCCAGTACTATAACCATGCCATAGACTGGCAGACAGGGAGTGGCTGCA
GT
GCAGCTGGCTTCTTTACTGTGTTCGCCAGTGAACTTTCTGTCTATACCCTTACAGTCATCACTCTGGA
A
AGGTGGCACACCATCACCTATGCTGTTCAGCTGGACCAAAAGCTGAGGCTGAGACATGCCATCCCAATT
ATG
CTCGGAGGATGGATTTTTTCTACCCTGATGGCCACATTGCCCCTTGTGGGTGTCAGCAGTTACATGA
AA
GTCAGCATCTGCCTCCCCATGGATGTGGAATCCACTCTGTCACAAGTCTACATATTATCCATCTTGCT
C
CTCAATGCAGTGGCCTTTGTCGTCATCTGTGCTTGCTACGTTAGGATATACTTTGCAGTTCAAAATCCA
GAG
CTGACGGCTCCTAACAAGGACACAAAAATTGCTAAGAAGATGGCCATCCTCATCTTCACAGACTTCA
CA
TGCATGGCACCCATCTCATTCTTTGCCATCTCAGCTGCCTTCAAAGTACCCCTTATCACTGTCACCAA
C
TCAAAAGTTCTGCTGGTCCTTTTTTATCCTGTCAATTCTTGTGCCAACCCATTTCTGTACGCAGTGTTC
ACG
AAGGCATTTCAGAGAGATTTCTTTCTCTTGCTGAGCAGATTTGGTTGCTGTAAGCACCGGGCTGAAC
TT
TACAGAAGGAAGGAATTTTCTGCATGTACCTTCAACTCCAAAAACGGCTTTCCAAGATCAAGTAAGCC
T
TCCCAGGCTGCCCTGAAGTTATCCATAGTGCACTGTCAACAACCTACACCTCCAAGAGTGTTAATTCAG
TAA


Translation (700 aa):
MGRRVPALRQLLVLAMLVLKQSQLHSPELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPS
Q
AFRGLNEVVK
IEISQSDSLERIEANAFDNLLNLSEILIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIR
T
LPDVSKISSSEFNFI
LEICDNLYITTIPGNAFQGMNNESITLKLYGNGFEEVQSHAFNGTTLISLELKE
N
IYLEKMHSGTFQGATGPSI
LDVSSTKLQALPSHGLESIQTLIATSSYSLKTLPSREKFTSLLVATLTYP
S
HCCAFRNLPKK
EQNFSFSIFENFSKQCESTVREANNETLYSAIFEENELSGWDYDYDFCSPKTLQCTPE
P
DAFNPCEDIMGYAFLRVLIWLINILAIFGNLTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIA
S
VDSQTKGQYYNHAIDWQTGSGCSAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQKLRLRHAIPI
M
LGGWIFSTLMATLPLVGVSSYMKVSICLPMDVESTLSQVYILSILLLNAVAFVVICACYVRIYFAVQNP
E
LTAPNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVLFYPVNSCANPFLYAVF
T
KAFQRDFFLLLSRFGCCKHRAELYRRKEFSACTFNSKNGFPRSSKPSQAALKLSIVHCQQPTPPRVLIQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser