NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29009.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29009.1 Public Mus musculus 17 Atp6v1e2 16 104 75 CCDS HistoryNCBI Gene:74915Re-query CCDS DB by CCDS ID:29009.1Re-query CCDS DB by GeneID:74915See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29009.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000065758 ENSMUSP00000065285 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000065758Link to Ensembl Protein Viewer:ENSMUSP00000065285Re-query CCDS DB by Nucleotide ID:ENSMUST00000065758Re-query CCDS DB by Protein ID:ENSMUSP00000065285
Original member Current member NCBI NM_029121.3 NP_083397.3 Accepted alive Link to Nucleotide Sequence:NM_029121.3Link to Protein Sequence:NP_083397.3Re-query CCDS DB by Nucleotide ID:NM_029121Re-query CCDS DB by Protein ID:NP_083397Link to BLink:NP_083397.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083397.3 226 Q9D593 226 100% 0 0

Chromosomal Locations for CCDS 29009.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 86944288 86944968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (681 nt):
ATGGCCCTGACTGACATAGACGTGCAGAAGCAGATCAAGCACATGATGGCGTTCATCGAGCAGGAAGCCA
AC
GAGAAGGCGGAGGAGATAGACGCCAAGGCGGAGGAAGAGTTCAACATTGAGAAGGGCCGCCTGGTGCA
G
ACCCAGCGGCTGAAGATCATGGATTATTTTGAGAAGAAGGAGAAACAGATTGAGCAGCAGAAAAAGATC
CAG
CTGTCCACCATGAGAAACCAGGCTCGCATCACGGTCCTGAGAGCCCGAGACAATCTCATCTTAGAAT
TG
CTCAAGGATGCCAAGATGAGGCTCAGCAGAATTGTGTCGGATGAAGAAATCTACCAGGACCTGCTGGA
T
AAGCTCGTGCTCCAAGCCTTGCTCCGGCTGCTGGAGCCTGTGATGATTGTCCGCTGCCGGCCACAGGAC
CTC
CACCTGGTGGAGTCTGCGGTGCTAAGAGCCATCCCTCAGTACATGAGGCTCTGCCAGAAGCATTTGG
AG
GTACAGGTTGACCAAACTGAACACTTGCCTTCCAATGCTGCTGGAGGGGTGGAGGTCTACAGCAGCGA
T
CAGAAAATAAAGGTTTCCAACACCCTGGAAAGTCGGCTGAATCTCGCGGCCATGCAGAAGATGCCAGAA
ATA
CGAGGGATTCTGTTTGGAGACAACACCAGCAGAAAGTTCTTTACATGA


Translation (226 aa):
MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKI
Q
LSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQD
L
HLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPE
I
RGILFGDNTSRKFFT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser