NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28837.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28837.1 Public Mus musculus 17 Pex6 16 104 75 CCDS HistoryNCBI Gene:224824Re-query CCDS DB by CCDS ID:28837.1Re-query CCDS DB by GeneID:224824See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28837.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000002840 ENSMUSP00000002840 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002840Link to Ensembl Protein Viewer:ENSMUSP00000002840Re-query CCDS DB by Nucleotide ID:ENSMUST00000002840Re-query CCDS DB by Protein ID:ENSMUSP00000002840
Original member Current member EBI,WTSI OTTMUST00000065100 OTTMUSP00000032402 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065100Link to Vega Protein Viewer:OTTMUSP00000032402Re-query CCDS DB by Nucleotide ID:OTTMUST00000065100Re-query CCDS DB by Protein ID:OTTMUSP00000032402
Original member Current member NCBI NM_145488.1 NP_663463.1 Accepted alive Link to Nucleotide Sequence:NM_145488.1Link to Protein Sequence:NP_663463.1Re-query CCDS DB by Nucleotide ID:NM_145488Re-query CCDS DB by Protein ID:NP_663463Link to BLink:NP_663463.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663463.1 981 Q99LC9 981 100% 0 0

Chromosomal Locations for CCDS 28837.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 46711500 46712384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46713908 46714071 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46714461 46714544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46720328 46720430 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46720512 46720645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46721183 46721294 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46721670 46721878 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46722244 46722439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46722622 46722698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46723112 46723244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46723324 46723529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46723674 46723735 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46723919 46724027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46724391 46724507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46724627 46724704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46724825 46724964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 46725188 46725324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2946 nt):
ATGGCGTTGGCTGTCCTGCGCGTCCTGGACCCCTTCCCGACGGAGACACCACCGTTGGCGGTGCTGTTGC
CT
CCCGGGGGCCCGTGGCCAGCGACGGGGCTGGGGCTGGTGCTGGCACTGCGGCCGGCGAGCGAGAGTCC
C
GCGAAGCCCGCGCTGCTCGTGGCGGCCGTGGAAGGGTCCGGCGCCCAGGGCGAGCAGCGCGGGCCGGGG
CCT
CCGCCGCTGCTGGTGAGCCGCGCGCTGCTGCGGGTCCTAGCGCTGGGGCCCGGGGCGCGAGTACGAG
CG
CGGCTTGTGCGGCGTCCCCCGGCCCTGGGCTGGGCGTTGCTTGCCACGGCTCCGGGACCCGGGCTAGG
G
CCTCGAGTCGGGCCGCTGTTGGTGCGCCGCGGGGAGACCCTCCCCGTGCCCGGATCGCGAGTGTTGGAG
ACG
CGACCGGCCCTGCAGGGGTTGCTGGGCCCGGGGACACGGCTGGCCGTGACTGAGCTCCGCGGGCGGG
CC
AAACTGGGCCAGGAGAGTCGGGATCACAGCCATCCCCCGCCCCCGCCCGTAGTGTCGTCCTTTGCAGC
T
TCCCACTCGGTCCGGCGACTCCGAGGGGTTCTGGGAGGGACTGGAGATGCGCTGGGTGTGAGCCGGAGC
TGT
CTCCGGAGTCTCGGACTCTTCCAGGGCGAATGGGTCTGGGTGGCCCAGGTCGCAGAGTTACCCAACT
CC
TCGCAGCCGCGCTTGGCTCAAGTCCAGGTTCTAGAACCGCGCTGGGAGCTGTCTGAGAGACTGGGACC
C
AACTCCGGGCAGCAGCCGGGAGAGCCACTCGCTGACGGACTGGTGTTTCTGCCCGCCACTCTGGCTTTT
AAT
CTCGGCTGTGACCCCCTGGAAGTGGGAGAGCTCAGAATTCAGAGGTATTTGGAAGGCTCCATCGCCC
CA
GAGAACAAAGGAAGCTGTTCACCACTGCCCGGGCCTCCGTTTGCTCGAGAGTTACACATTGAGATTCT
G
TCCTCGCCTCACTACAGTGCTAATGGAAATTATGACCATGTCCTGTACCGGCACTTTCAGACACCCAGG
GTG
GTCCAGGAAGGGGATGTGTTGTGTGTGTCAACAGCTGGGCAAGTTGAGATCCTGGAAGGAAGCCTGG
AG
AGACTGCCCAGGTGGCGGGAGATGTTTTTCAAAGTGAAGAAAACGGTTGGAGAAGCCCCAGAGGGGCC
A
GCCAGTGCCTTTCTGGCTGATACCACCCACACCTCTTTATACCTGGCTGGCACCGCCCTGAGTCATGTG
CCA
TCGCTGCCTTCAGGAAGGTCCCCACCCTGGGACAGCTTGTCTCCTCCAGGCCTGGAGGCCTTGGTAA
AT
GAGCTGTGTGCTATCCTGAAGCCTCACCTGCAGCCCGGAGGAACATTGCTCACAGGAACCAGCTGTGT
G
CTTCTGCAGGGTCCCCCAGGCAGCGGGAAGACCACAGCCGTCACGGCTGCATGCAGCCGCCTTGGGCTC
CAT
TTGCTGAAGGTGCCCTGCTCCAGCCTCTGTGCAGACAGCAGTAGGGCCGTGGAGACAAAGCTGCAGG
CC
ACCTTCTCCCGGGCCCGCCGCTGCAGGCCTGCAGTCCTCCTGTTGACAGCTGTGGACCTCCTGGGCCG
G
GACCGAGACGGACTGGGTGAGGATGCCCGTGTTGCGGCCACACTCCGTCATCTCCTCCTTGATGAGGAC
GCT
CTCAGCAGGTGCCCTCCTCTCATGGTGGTGGCTACCACAAGCCGTGTCCAGGACCTGCCCACCGATG
TG
CAGACGGCATTTCCTCATGAGCTAGAGGTGCCAGTGCTGTCTGAGGCTCAACGGCTCAGTATCCTGCA
G
GCCCTCACTGCCCACCTTCCCTTAGGCCAGGAGGTTAACCTGCCCCAGCTGGCACGGCGCTGTGCGGGC
TTT
GTGGTGGGGGACCTCTATGCCCTTCTGACCCATACCTGCCGGGCAGCCTGCACCAGGATCAGAGCCT
CG
GGCTCGGCAGGTGGTTTGAGTGAGGAGGATGAGGGGGACCTGTGTGTGGCTGGCTTTCCTTTGCTGGC
T
GAGGACTTCGGGCAGGCATTAGATCAACTGCAGACAGCTCACTCCCAAGCTGTGGGAGCACCCAGGATC
CCT
TCAGTGTCCTGGCACGACGTGGGCGGGCTGCAGGATGTGAAGAAGGAGATCCTAGAAACCATCCAGC
TG
CCTCTGGAACACCCTGAGCTGCTCAGCCTGGGCCTAAGACGATCAGGCCTTCTGCTCCATGGGCCCCC
A
GGCACTGGCAAGACCCTGCTGGCCAAGGCCGTAGCCACTGAGTGCAGCCTCACCTTCCTCAGTGTAAAG
GGA
CCGGAGCTCATCAACATGTATGTGGGCCAAAGCGAGGAGAATGTCCGGGAAGTGTTTGCCAGGGCCA
GG
GCTGCTGCTCCCTGTATCATCTTCTTTGATGAACTGGATTCCTTAGCTCCAAGCCGCGGACGGAGTGG
A
GATTCTGGAGGGGTGATGGACAGAGTTGTGTCTCAGCTCCTAGCCGAGCTGGATGGGCTCCACAGCACC
CAG
GATGTGTTTGTGATCGGAGCCACCAACAGACCAGACCTCCTGGACCCTGCCCTTCTGCGGCCTGGCA
G
A
TTTGACAAGCTGGTGTTTGTAGGGGCGAGTGAGGACCGGGCCTCCCAGCTGCGTGTGCTGAGCGCCAT
C
ACACGGAAGTTCAAGCTGGAGGCCTCTGTGAGCCTGGCAAACGTGCTGGATTGCTGCCCACCCCAGCTG
ACT
GGTGCAGATCTCTATTCTCTCTGCTCTGACGCCATGATGACTGCCCTCAAACGCAGGGTTCGAGACC
TA
GAGGAAGGGCTAGAGCTGCGGAGCTCAGCACTGCTGCTCACCATGGAGGACCTGTTGCAGGCTGCAGC
C
CGGCTGCAGCCCTCAGTCAGTGAGCAGGAGCTGTTGCGATACAAGCGCATCCAACGCAAGTTTGCCGCC
TGC
TAG


Translation (981 aa):
MALAVLRVLDPFPTETPPLAVLLPPGGPWPATGLGLVLALRPASESPAKPALLVAAVEGSGAQGEQRGPG
P
PPLLVSRALLRVLALGPGARVRARLVRRPPALGWALLATAPGPGLGPRVGPLLVRRGETLPVPGSRVLE
T
RPALQGLLGPGTRLAVTELRGRAKLGQESRDHSHPPPPPVVSSFAASHSVRRLRGVLGGTGDALGVSRS
C
LRSLGLFQGEWVWVAQVAELPNSSQPRLAQVQVLEPRWELSERLGPNSGQQPGEPLADGLVFLPATLAF
N
LGCDPLEVGELRIQ
RYLEGSIAPENKGSCSPLPGPPFARELHIEILSSPHYSANGNYDHVLYRHFQTPR
V
VQEGDVLCVSTAGQVEILEGSLERLP
RWREMFFKVKKTVGEAPEGPASAFLADTTHTSLYLAGTALSHV
P
SLPSGRSPPWDSLSPPGLEALVNELCAILKPHLQP
GGTLLTGTSCVLLQGPPGSGKTTAVTAACSRLGL
H
LLK
VPCSSLCADSSRAVETKLQATFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVAATLRHLLLDED
A
LS
RCPPLMVVATTSRVQDLPTDVQTAFPHELEVPVLSEAQRLSILQALTAHLPLGQEVNLPQLARRCAG
F
VVGDLYALLTHTCRAACTRIRAS
GSAGGLSEEDEGDLCVAGFPLLAEDFGQALDQLQTAHSQAVGAPRI
P
SVSWHDVGGLQDVKKEILETIQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFL
SVK
G
PELINMYVGQSEENVRE
VFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHST
Q
DVFVIGATNRPDLLDPALLRPG
RFDKLVFVGASEDRASQLRVLSAITRKFKLEASVSLANVLDCCPPQL
T
GADLYSLCSDAMMTALKRRVRDLEE
GLELRSSALLLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAA
C




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser