NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28281.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28281.1 Public Mus musculus 16 Ncam2 16 104 75 CCDS HistoryNCBI Gene:17968Re-query CCDS DB by CCDS ID:28281.1Re-query CCDS DB by GeneID:17968

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28281.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000037785 ENSMUSP00000049390 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037785Link to Ensembl Protein Viewer:ENSMUSP00000049390Re-query CCDS DB by Nucleotide ID:ENSMUST00000037785Re-query CCDS DB by Protein ID:ENSMUSP00000049390
Original member Current member EBI,WTSI OTTMUST00000035515 OTTMUSP00000015900 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035515Link to Vega Protein Viewer:OTTMUSP00000015900Re-query CCDS DB by Nucleotide ID:OTTMUST00000035515Re-query CCDS DB by Protein ID:OTTMUSP00000015900
Original member Current member NCBI NM_010954.4 NP_035084.1 Accepted alive Link to Nucleotide Sequence:NM_010954.4Link to Protein Sequence:NP_035084.1Re-query CCDS DB by Nucleotide ID:NM_010954Re-query CCDS DB by Protein ID:NP_035084Link to BLink:NP_035084.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035084.1 727 O35136-2 727 100% 0 0

Chromosomal Locations for CCDS 28281.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

Chromosome Start Stop Links
16 81200914 81200968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81432709 81432783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81434780 81434986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81437596 81437739 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81443134 81443271 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81455290 81455407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81461569 81461729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81465559 81465704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81490244 81490394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81512819 81513006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81517521 81517617 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81526950 81527123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81576053 81576172 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81578690 81578811 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81589631 81589811 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 81595207 81595313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2184 nt):
ATGAGCCTCCTCCTCTCCTTCTACCTGCTCGGGTTGCTTGTCAGGAGCGGGCAAGCTCTTCTTCAAGTGA
CA
ATTTCACTTAGCAAAGTAGAGCTTAGTGTGGGTGAGTCTAAATTCTTCACATGTACAGCCATTGGTGA
G
CCTGAGAGTATCGACTGGTATAACCCTCAAGGAGAGAAGATCATTTCAACGCAGAGGGTTATGCTACAG
AAG
GAGGGTGTCAGGTCACGACTCACCATCTACAATGCAAACATAGAAGATGCAGGGATATATCGCTGTC
AA
GCGACAGATGCCAAAGGACAGACACAAGAAGCTACAGTAGTTTTGGAAATTTACCAAAAACTCACCTT
C
AGAGAAGTGGTGTCCCCTCAAGAGTTCAAGCAAGGGGAGGATGCAGAAGTGGTTTGCAGAGTGAGCAGT
TCC
CCAGCCCCTGCGGTCAGCTGGTTGTACCACAATGAGGAAGTCACCACCATCCCCGACAATCGGTTTG
CA
GTGCTTGCAAACAATAATTTGCAGATCCTCAATATCAATAAAAGTGATGAAGGTATATACAGATGTGA
A
GGAAGAGTGGAGGCGAGGGGAGAGATTGACTTCCGGGATATCATTGTTATTGTTAACGTTCCACCAGCA
ATC
ATGATGCCCCAGAAGTCCTTCAATGCTACAGCAGAGAGAGGAGAAGAGATGACCTTAACATGCAAGG
CC
TCGGGCTCCCCAGATCCAACCATCTCTTGGTTCAGGAACGGCAAACTCATTGAAGAAAATGAAAAGTA
T
ATTTTAAAGGGCAGTAATACAGAGCTCACTGTCAGGAACATAATCAATAAAGACGGGGGCTCTTATGTC
TGC
AAAGCAACAAACAAGGCAGGAGAAGATCAAAAGCAGGCCTTCCTTCAAGTCTTTGTACAGCCTCATA
TA
TTACAACTTAAAAATGAGACAACATCTGAGAATGGTCATGTCACACTCGTATGTGAAGCAGAAGGGGA
G
CCTGTTCCAGAAATCACATGGAAAAGAGCCATAGATGGAGTCATGTTTTCTGAAGGTGATAAGAGTCCG
GAT
GGCCGCATCGAAGTTAAAGGGCAGCATGGACGCTCTTCACTGCACATTAGAGATGTGAAGTTGTCAG
AT
TCGGGGAGATATGACTGTGAGGCCGCTAGTCGGATTGGTGGGCACCAGAGGAGCATGCACCTGGACAT
C
GAATATGCTCCTAAGTTTGTTTCAAATCAGACAATGTATTACTCTTGGGAAGGAAATCCAATCAACATA
AGT
TGTGATGTGACAGCAAACCCACCTGCGTCAATCCACTGGAGAAGAGAGAAACTGCTCTTACCAGCTA
AG
AATACGACTCATTTAAAAACTCACAGTGTAGGAAGAAAGATGATACTCGAGATTGCCCCCACATCAGA
C
AATGACTTTGGACGATATAACTGCACAGCTACTAACCGTATAGGCACAAGATTTCAGGAATATATTCTT
GAA
TTAGCAGATGTCCCCTCTAGTCCCCATGGAGTGAAGATTATAGAGCTGTCACAGACCACAGCCAAGA
TC
TCTTTCAATAAACCCGAATCCCATGGAGGTGTGCCTATTCATCACTATCAAGTGGATGTCAAAGAAGT
G
GCATCAGAAACCTGGAAAATAGTACGCTCCCATGGAGTTCAAACGATGGTTGTTTTGAGCAGTCTGGAA
CCA
AATACGACTTACGAAATTAGGGTTGCAGCAGTGAATGGCAAAGGTCAAGGAGACTACAGTAAAATAG
AA
ATATTCCAGACACTGCCAGTCCGTGAGCCAAGTCCCCCTTCCATACATGGACAGCCAAGCAGTGGCAA
G
AGTTTTAAAATCAGCATCACCAAGCAAGATGATGGAGGGGCTCCTATTTTAGAATACATTGTAAAATAC
AGA
AGTAAAGACAAGGAAGATCAGTGGCTAGAGAAGAAGGTACAGGGAAATAAAGACCACATTATCTTGG
AG
CATCTGCAGTGGACAATGGGCTACGAAGTGCAAATCACAGCTGCCAACAGACTGGGATATTCTGAGCC
T
ACTGTATATGAGTTCAGCATGCCCCCAAAACCCAACATTATTAAAGATAATTGCTGTGAAGCGAATAAA
GGT
GAAAATGGAGGCCAGTCATGGCATCTGAATGCTGTTGGGTTTACTTTTGTAATAACCATGAGTTTGT
CT
TGTTTGTTTTAG


Translation (727 aa):
MSLLLSFYLLGLLVRSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVMLQ
K
EGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIY
QKLTFREVVSPQEFKQGEDAEVVCRVSS
S
PAPAVSWLYHNEEVTTIPD
NRFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPA
I
MMPQKSFNATAERGEEMTLTCKASGSPDPTISWF
RNGKLIEENEKYILKGSNTELTVRNIINKDGGSYV
C
KATNKAGEDQKQAFLQVF
VQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDGVMFSEGDKSP
D
GRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIE
YAPKFVSNQTMYYSWEGNPINI
S
CDVTANPPASIHWRREKLLLPAKNTTHLKTHSVGRKMILE
IAPTSDNDFGRYNCTATNRIGTRFQEYIL
E
LA
DVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHYQVDVKEVASETWKIVRSHGVQTMVVLSSLE
P
NTTYEIRVAAVNGKGQGDYSKIEIFQTLPV
REPSPPSIHGQPSSGKSFKISITKQDDGGAPILEYIVKY
R
S
KDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDNCCEANK
G
ENGGQSWHLNAVGFTFVITMSLSCLF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser