NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27904.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27904.1 Public Mus musculus 15 Pde1b 16 104 75 CCDS HistoryNCBI Gene:18574Re-query CCDS DB by CCDS ID:27904.1Re-query CCDS DB by GeneID:18574See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27904.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023132 ENSMUSP00000023132 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023132Link to Ensembl Protein Viewer:ENSMUSP00000023132Re-query CCDS DB by Nucleotide ID:ENSMUST00000023132Re-query CCDS DB by Protein ID:ENSMUSP00000023132
Original member Current member NCBI NM_008800.2 NP_032826.1 Accepted alive Link to Nucleotide Sequence:NM_008800.2Link to Protein Sequence:NP_032826.1Re-query CCDS DB by Nucleotide ID:NM_008800Re-query CCDS DB by Protein ID:NP_032826Link to BLink:NP_032826.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032826.1 535 Q01065 535 100% 0 0

Chromosomal Locations for CCDS 27904.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 103503474 103503583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103519949 103520062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103521306 103521488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103521653 103521719 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103522045 103522161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103524308 103524448 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103524798 103524898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103524990 103525115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103525236 103525337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103526263 103526383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103526607 103526688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103526984 103527092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103527545 103527675 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 103528222 103528325 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1608 nt):
ATGGAGCTGTCCCCCCGCAGTCCTCCAGAGATGCTGGAGTCGGATTGCCCGTCACCCCTGGAGCTGAAGT
CA
GCCCCCAGCAAGAAAATGTGGATTAAGCTACGGTCTCTGCTGCGCTACATGGTGAAGCAGTTGGAGAA
T
GGGGAGGTTAACATCGAGGAGCTGAAGAAAAACCTGGAATACACAGCTTCCCTGCTGGAAGCTGTCTAC
ATT
GATGAGACAAGGCAAATCCTAGACACTGAAGATGAGCTTCGGGAACTTCGGTCAGATGCTGTGCCTT
CA
GAGGTGCGGGACTGGTTGGCCTCCACCTTCACCCAGCAGACCCGAGCCAAAGGTCGCAGGGCAGAAGA
G
AAACCCAAGTTCCGAAGCATCGTGCATGCTGTGCAGGCTGGGATCTTCGTGGAGCGGATGTTCCGGAGA
ACG
TATACCTCTGTGGGCCCCACATACTCTACTGCAGTCCACAACTGTCTCAAGAACCTGGACCTCTGGT
GC
TTTGATGTCTTTTCCTTGAACCGGGCAGCCGATGACCACGCTCTGAGGACCATTGTTTTTGAGTTGCT
G
ACTCGGCATAGCCTCATCAGCCGCTTTAAGATTCCCACAGTGTTTCTGATGAGTTTTCTGGAGGCCTTG
GAG
ACAGGCTATGGGAAATATAAGAATCCTTACCACAACCAGATCCACGCAGCCGACGTGACCCAGACTG
TC
CATTGCTTCCTTCTCCGCACAGGCATGGTGCACTGCCTGTCAGAGATTGAGGTCTTGGCCATCATCTT
T
GCTGCAGCCATCCATGACTATGAGCACACAGGCACAACCAACAGCTTCCACATTCAGACCAAGTCAGAA
TGT
GCCATCCTGTACAATGATCGATCGGTGCTGGAGAATCACCACATCAGCTCTGTCTTTCGAATGATGC
AG
GATGATGAGATGAACATTTTTATCAATCTCACCAAGGATGAATTTGCAGAGCTGCGGGCCCTGGTTAT
C
GAGATGGTGTTGGCCACAGACATGTCCTGCCATTTCCAGCAAGTGAAGACTATGAAGACAGCACTGCAG
CAG
TTGGAAAGGATTGACAAGTCCAAGGCCCTATCTCTTCTGCTTCATGCTGCTGACATCAGCCACCCAA
CT
AAGCAGTGGTCAGTCCACAGCCGCTGGACCAAGGCCCTAATGGAAGAGTTCTTCCGCCAGGGTGACAA
G
GAGGCAGAGCTGGGCCTGCCCTTCTCTCCACTCTGTGATCGCACTTCCACATTGGTGGCCCAGTCCCAG
ATA
GGTTTCATTGACTTCATTGTGGAGCCAACCTTCTCTGTGCTGACTGATGTGGCAGAAAAGAGTGTCC
AG
CCCTTGGCAGATGATGATTCCAAGCCTAAAAGTCAGCCCAGCTTCCAGTGGCGCCAGCCTTCTTTAGA
T
GTGGACGTAGGAGACCCCAACCCTGATGTGGTCAGTTTCCGTGCCACCTGGACCAAGTACATTCAAGAG
AAC
AAACAGAAGTGGAAGGAACGGGCAGCAAGTGGCATCACCAACCAGATGTCCATTGATGAACTGTCCC
CC
TGTGAGGAAGAAGCCCCATCCTCCCCTGCAGAAGATGAGCACAACCAGAATGGGAATCTGGATTAG


Translation (535 aa):
MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNLEYTASLLEAVY
I
DET
RQILDTEDELRELRSDAVPSEVRDWLASTFTQQTRAKGRRAEEKPKFRSIVHAVQAGIFVERMFRR
T
YTSVGPTYSTAVHNCLK
NLDLWCFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIPTVFLMSFLEAL
E
TGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMV
HCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSE
C
AILYNDRSVLENHHISSVFRMMQDDEMNIFINLTKDEF
AELRALVIEMVLATDMSCHFQQVKTMKTALQ
Q
LE
RIDKSKALSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQ
I
GFIDFIVEPTFSVLTDVAEKSVQPLADDDSKPKSQPSFQWRQPSLDVDVGDPNPDVVSFRATWTKYIQE
N
KQKWKERAAS
GITNQMSIDELSPCEEEAPSSPAEDEHNQNGNLD



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser