NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27852.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27852.1 Public Mus musculus 15 Krt83 16 104 75 CCDS HistoryNCBI Gene:406219Re-query CCDS DB by CCDS ID:27852.1Re-query CCDS DB by GeneID:406219See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27852.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000081945 ENSMUSP00000080613 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081945Link to Ensembl Protein Viewer:ENSMUSP00000080613Re-query CCDS DB by Nucleotide ID:ENSMUST00000081945Re-query CCDS DB by Protein ID:ENSMUSP00000080613
Original member Current member NCBI NM_001003668.2 NP_001003668.2 Accepted alive Link to Nucleotide Sequence:NM_001003668.2Link to Protein Sequence:NP_001003668.2Re-query CCDS DB by Nucleotide ID:NM_001003668Re-query CCDS DB by Protein ID:NP_001003668Link to BLink:NP_001003668.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001003668.2 495 Q6IMF0 495 100% 0 0

Chromosomal Locations for CCDS 27852.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 101431794 101431987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101432344 101432375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101433102 101433322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101433592 101433717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101433941 101434105 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101434581 101434676 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101435481 101435541 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101436532 101436740 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101438387 101438770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGTCTTGCTTCTCCTCCCGCCTCGGAGCCTCCTGTGGGGTCCGCGCCTTCAGCTGCGCCTCGGCATGTG
GT
CCCCGGCCCGGCCGCTGCTGCATCTCTGCAGCTCCCTACAGGGGCATCTCCTGCTACCGCGGACTCTC
A
GGGGGCTTCGGCAGCCGCAGCGTCTGCGGGCCCTTCCGCTCTGGCTCCTGTGGACGCAGCTTCGGGTAC
CGA
TCTGGAGGCGTCTGCGGGCCCAGCCCCCCCTGCATCACCACCGTCTCTGTCAATGAGAGCCTGCTCA
CA
CCCCTGAACCTGGAGATCGACCCCAATGCTCAGTGTGTGAAGCATGAGGAGAAGGAGCAGATCAAGTG
T
CTCAACAGCAAGTTCGCAGCCTTCATCGACAAGGTGCGCTTCCTGGAGCAGCAGAACAAGCTGCTGGAG
ACC
AAGTGGCAGTTCTACCAGAACCGCAAGTGTTGTGAGAGCAACATGGAGCCTCTGTTCGAGGGCTACA
TC
GAGGCGCTGAGGCGGGAGGCTGAGTGTGTGGAGGCCGACAGCGGGAGGCTGGCAGCCGAGCTCAACCA
T
GTGCAGGAGTCCATGGAGGGCTACAAGAAGAGGTATGAAGAGGAAGTGGCACTACGAGCCACTTCTGAG
AAT
GAATTTGTGGCCCTGAAGAAGGATGTGGACTGTGCCTACCTCCGGAAGTCAGACCTGGAGGCCAACG
CA
GAAGCGCTGACACAGGAGACCGACTTCCTGAGGCAACTGTATGAAGAGGAAACACGTCTCCTCCATTC
C
CACATCTCAGACACCTCCGTCGTCGTCAAGATGGACAACAGCCGGGACCTGAACATGGACTGTGTCGTG
GCT
GAGATCAAGGCTCAGTATGATGACATTGCCAGCCGTAGCCGTGCTGAGGCTGAGTCCTGGTACCGCA
CC
AAGTGTGAGGAGATGAAGGCCACAGTGATCCGGCATGGAGAGACCCTGCGCCGCACCAGAGAGGAGAT
C
AATGAGCTGAACAGAATGATCCAGAGGCTGACTGCTGAGATCGAGAATGCCAAGTGCCAGAACACCAAG
CTG
GAGGCTGCTGTGACCCAATCTGAGCAACAGGGAGAGGCTGCCCTCACTGATGCCCGCTGCAAGCTGG
CT
GAGCTGGAGGGTGCCCTGCAGAAGGCTAAGCAGGATATGGCCTGCCTGCTCAAGGAATACCAGGAGGT
G
ATGAACTCCAAGTTGGGGCTGGATGTCGAGATCATCACCTACAGGCGCCTGCTGGAGGGCGAGGAGCAG
AG
G
CTCTGCGAGGGTGTGGGCTCTGTGAATGTCTGTGTCAGCAGCTCCCGTGGAGGAGTCACATGTGGGG
GC
CTCACCTATGGCACAACCCCAGGGCGCCAGATTGCCTCTGGACCCTCTGTCACTGGGGGCAGCATCAC
A
GTGATGGCCCCTGACTCCTGCTCTCCTTGCCAGCCCCGCGCCTCCAGCTTCACCTGTGGGAGCAGCCGC
TCA
GTGCGCTTCGCTTAG


Translation (495 aa):
MSCFSSRLGASCGVRAFSCASACGPRPGRCCISAAPYRGISCYRGLSGGFGSRSVCGPFRSGSCGRSFGY
R
SGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNSKFAAFIDK
VRFLEQQNKLLE
T
KWQFYQNRKCCESNMEPLFEGYIEALRREAECVEADSGRLAAELNHVQESMEGYKK
RYEEEVALRATSE
N
EFVALKK
DVDCAYLRKSDLEANAEALTQETDFLRQLYEEETRLLHSHISDTSVVVKMDNSRDLNMDCVV
A
EIKAQYDDIASRSRAEAESWYRTK
CEEMKATVIRHGETLRRTREEINELNRMIQRLTAEIENAKCQNTK
L
EAAVTQSEQQGEAALTDARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDVEIITYRRLLEGEEQ

R
LCEGVGSVNVCVSSSRGGVTCGGLTYGTTPGRQIASGPSVTGGSITVMAPDSCSPCQPRASSFTCGSSR
S
VRFA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser