NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27813.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27813.1 Public Mus musculus 15 Prph 16 104 75 CCDS HistoryNCBI Gene:19132Re-query CCDS DB by CCDS ID:27813.1Re-query CCDS DB by GeneID:19132

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27813.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000047104 ENSMUSP00000049303 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000047104Link to Ensembl Protein Viewer:ENSMUSP00000049303Re-query CCDS DB by Nucleotide ID:ENSMUST00000047104Re-query CCDS DB by Protein ID:ENSMUSP00000049303
Original member Current member NCBI NM_013639.2 NP_038667.2 Accepted alive Link to Nucleotide Sequence:NM_013639.2Link to Protein Sequence:NP_038667.2Re-query CCDS DB by Nucleotide ID:NM_013639Re-query CCDS DB by Protein ID:NP_038667Link to BLink:NP_038667.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038667.2 507 P15331-2 507 99.8028% 0 1

Chromosomal Locations for CCDS 27813.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

Chromosome Start Stop Links
15 99055207 99055763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99056104 99056164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99056341 99056436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99056769 99057158 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057258 99057478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057568 99057617 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057816 99057895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99058602 99058670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1524 nt):
ATGCCATCTTCCGCCAGCATGAGCCATCATCACTCGTCGGGCCTGCGGTCCAGCATCAGCTCCACCTCGT
AC
CGCCGGACCTTTGGGCCGCCGCCCTCACTGTCCCCCGGGGCTTTCTCCTACTCGTCCAGCTCTCGCTT
C
TCCAGCAGCCGCCTGCTGGGCTCGGGGTCCCCGAGCTCCTCGGCGCGGCTGGGCAGCTTCCGTGCCCCT
CGA
GCGGGGGCACTGCGCTTGCCCTCGGAGCGCCTCGATTTCTCCATGGCCGAGGCCCTCAACCAAGAGT
TC
CTGGCCACTCGGAGCAACGAGAAGCAAGAGTTACAGGAGCTCAACGACCGCTTCGCCAACTTCATCGA
G
AAGGTGCGCTTCTTGGAGCAGCAGAACGCAGCCCTGCGCGGGGAGCTGAGCCAGGCGCGGGGCCAGGAG
CCG
GCGCGCGCCGACCAGCTTTGCCAGCAGGAGCTGCGCGAGCTGCGGCGCGAACTGGAGCTGCTGGGCC
GG
GAGCGCGACCGGGTGCAGGTGGAGCGGGACGGGCTGGCGGAGGACCTAGCGGCGCTCAAGCAGAGGTT
A
GAAGAAGAAACCCGCAAGCGGGAGGATGCGGAGCACAACCTGGTGCTCTTCCGTAAGGACGTGGACGAC
GCC
ACTCTGTCCCGCCTAGAACTGGAGCGCAAGATTGAGTCTCTGATGGATGAAATTGAGTTCCTCAAGA
AG
CTACACGAAGAGGAACTTCGAGACCTGCAGGTGAGCGTAGAGAGCCAGCAGGTGCAGCAGGTGGAGGT
A
GAGGCAACAGTGAAGCCAGAGCTGACGGCGGCGCTGAGGGACATCCGTGCACAGTACGAGAACATCGCG
GCA
AAGAATCTGCAGGAGGCAGAGGAGTGGTATAAGTCGAAAGTGCGAGAGCATTGGGGGAACCCTGGGG
GA
CCAAGGGTGGGGAGGCACTGGGAATGGCGGTGCGCATCCCAGCCGGGCTTGTCTGCTACCGCGCAGTA
T
GCTGACCTGTCGGACGCCGCCAACCGCAACCATGAGGCCCTACGCCAGGCCAAGCAAGAGATGAACGAG
TCT
CGACGTCAGATCCAGAGTCTGATGTGCGAGGTGGATGGGCTGCGAGGCACGAATGAGGCGCTGCTCA
GA
CAGCTGCGGGAGCTGGAAGAGCAGTTCGCCCTGGAGGCTGGAGGGTACCAAGCAGGCGCAGCACGGCT
G
GAGGAAGAGCTTCGACAGCTGAAGGAAGAGATGGCGAGGCACCTGCGAGAGTACCAGGAGCTCCTTAAC
GTC
AAGATGGCCCTGGACATCGAGATAGCCACCTACAGGAAGCTACTGGAAGGGGAGGAGAGCCGGATCT
CA
GTGCCGGTTCATTCCTTTGCCTCTCTAAGTTTAAAGACGACTGTGCCTGAGATGGAGCCTCTCCAGGA
T
AGCCACAGCAAGAAGATGGTTCTGATCAGGACAATTGAGACCCGGGATGGGGAGAAGGTGGTGACAGAG
TCC
CAGAAGGAACAGCACAGTGACCTGGACAAGTCTTCTATCCACAGCTACTGA


Translation (507 aa):
MPSSASMSHHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSSARLGSFRAP
R
AGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQE
P
ARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQ
RLEEETRKREDAEHNLVLFRKDVDD
A
TLSRLELERKIESLMDEIEFLKKLHEE
ELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYENIA
A
KNLQEAEEWYKSKVREHWGNPGGPRVGRHWEWRCASQPGLSATAQYADLSDAANRNHEALRQAKQEMNE
S
RRQIQSLMCEVDGLRGT
NEALLRQLRELEEQFALEAGGYQAGAARLEEELRQLKEEMARHLREYQELLN
V
KMALDIEIATYRKLLEGEES
RISVPVHSFASLSLKTTVPEMEPLQDSHSKKMVLIRTIETRDGEKVVTE
S
QKEQHSDLDKSSIHSY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser