NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27572.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27572.1 Public Mus musculus 15 Hsf1 16 104 75 CCDS HistoryNCBI Gene:15499Re-query CCDS DB by CCDS ID:27572.1Re-query CCDS DB by GeneID:15499

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27572.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000072838 ENSMUSP00000072617 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072838Link to Ensembl Protein Viewer:ENSMUSP00000072617Re-query CCDS DB by Nucleotide ID:ENSMUST00000072838Re-query CCDS DB by Protein ID:ENSMUSP00000072617
Original member Current member NCBI NM_008296.2 NP_032322.1 Accepted alive Link to Nucleotide Sequence:NM_008296.2Link to Protein Sequence:NP_032322.1Re-query CCDS DB by Nucleotide ID:NM_008296Re-query CCDS DB by Protein ID:NP_032322Link to BLink:NP_032322.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032322.1 503 P38532-2 503 100% 0 0

Chromosomal Locations for CCDS 27572.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

Chromosome Start Stop Links
15 76477601 76477717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76495970 76496078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76496453 76496589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76496836 76496960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76497619 76497694 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76497768 76497829 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76497952 76498048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76498154 76498290 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76498422 76498691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76499948 76500053 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76500267 76500336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76500417 76500622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1512 nt):
ATGGATCTGGCCGTGGGCCCCGGTGCAGCGGGGCCCAGCAACGTCCCGGCCTTCCTAACCAAGCTGTGGA
CC
CTCGTGAGCGACCCGGACACAGACGCGCTCATCTGCTGGAGCCCGAGTGGGAACAGCTTCCACGTGTT
T
GACCAGGGCCAGTTTGCCAAGGAGGTGCTGCCCAAGTACTTCAAGCACAACAACATGGCTAGCTTCGTG
CGG
CAGCTCAACATGTATGGCTTCCGAAAAGTAGTCCACATTGAGCAGGGTGGCCTGGTCAAGCCTGAGA
GA
GATGACACCGAGTTCCAGCATCCTTGTTTCTTGCGTGGACAGGAACAGCTCCTTGAGAACATCAAGAG
G
AAAGTGACCAGCGTGTCCACCCTGAAGAGTGAGGACATAAAAATACGCCAGGACAGTGTCACCCGGCTG
TTG
ACAGATGTGCAGCTGATGAAGGGGAAACAGGAGTGTATGGACTCCAAGCTCCTGGCCATGAAGCACG
AG
AACGAGGCCCTGTGGCGGGAGGTGGCCAGCCTTCGGCAGAAGCATGCCCAGCAGCAAAAAGTTGTCAA
C
AAGCTCATTCAGTTCCTGATCTCACTGGTGCAGTCGAACCGGATCCTGGGGGTGAAGAGAAAGATCCCT
CTG
ATGTTGAGTGACAGCAACTCAGCACACTCTGTGCCCAAGTATGGTCGACAGTACTCCCTGGAGCATG
TC
CATGGTCCTGGCCCATACTCAGCTCCATCTCCAGCCTACAGCAGCTCTAGCCTTTACTCCTCTGATGC
T
GTCACCAGCTCTGGACCCATAATCTCCGATATCACTGAGCTGGCTCCCACCAGCCCTTTGGCCTCCCCA
GGC
AGGAGCATAGATGAGAGGCCTCTGTCCAGCAGCACTCTGGTCCGTGTCAAGCAAGAGCCCCCCAGCC
CA
CCTCACAGCCCTCGGGTACTGGAGGCGAGCCCTGGGCGCCCATCCTCCATGGATACCCCTTTGTCCCC
A
ACTGCCTTCATTGACTCCATCCTTCGAGAGAGCGAGCCTACCCCTGCTGCCTCAAACACAGCCCCTATG
GAC
ACAACCGGAGCCCAAGCCCCCGCACTCCCGACCCCCTCCACCCCTGAGAAGTGCCTCAGCGTAGCCT
GC
CTAGACAAGAACGAGCTAAGTGATCACCTGGATGCCATGGACTCCAACCTGGACAACCTGCAGACCAT
G
CTGACAAGCCACGGCTTCAGTGTGGACACCAGTGCCCTGCTGGACATTCAGGAGCTTCTGTCTCCACAA
GAG
CCTCCCAGGCCTATTGAGGCAGAGAACAGTAACCCCGACTCAGGAAAGCAGCTGGTGCACTACACGG
CT
CAGCCTCTGTTCCTGCTGGATCCTGATGCTGTGGACACAGGGAGCAGTGAGCTGCCTGTGCTCTTTGA
G
CTGGGGGAGAGCTCCTACTTCTCTGAGGGGGATGACTACACGGATGATCCCACCATCTCTCTTCTGACA
GGC
ACTGAACCCCATAAAGCCAAGGACCCCACTGTCTCCTAG


Translation (503 aa):
MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFV
R
QLNM
YGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTRL
L
TDVQLMKGKQECMDSKLLAMK
HENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIP
L
MLSDSNSAHSVPKYGRQYSLEHVHGPGPYS
APSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASP
G
RSIDE
RPLSSSTLVRVKQEPPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPM
D
TTGAQAPALPTPSTPEKCLSVACLD
KNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDIQELLSPQ
E
PPRPIEAENSNPDS
GKQLVHYTAQPLFLLDPDAVDTGSSELPVLFELGESSYFSEGDDYTDDPTISLLT
G
TEPHKAKDPTVS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser