NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27317.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27317.1 Public Mus musculus 14 Ednrb 16 104 75 CCDS HistoryNCBI Gene:13618Re-query CCDS DB by CCDS ID:27317.1Re-query CCDS DB by GeneID:13618

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27317.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022718 ENSMUSP00000022718 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022718Link to Ensembl Protein Viewer:ENSMUSP00000022718Re-query CCDS DB by Nucleotide ID:ENSMUST00000022718Re-query CCDS DB by Protein ID:ENSMUSP00000022718
Original member Current member EBI,WTSI ENSMUST00000172237 ENSMUSP00000126057 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000172237Link to Ensembl Protein Viewer:ENSMUSP00000126057Re-query CCDS DB by Nucleotide ID:ENSMUST00000172237Re-query CCDS DB by Protein ID:ENSMUSP00000126057
Original member Current member NCBI NM_001136061.2 NP_001129533.1 Accepted alive Link to Nucleotide Sequence:NM_001136061.2Link to Protein Sequence:NP_001129533.1Re-query CCDS DB by Nucleotide ID:NM_001136061Re-query CCDS DB by Protein ID:NP_001129533Link to BLink:NP_001129533.1
Original member Current member NCBI NM_001276296.1 NP_001263225.1 Accepted alive Link to Nucleotide Sequence:NM_001276296.1Link to Protein Sequence:NP_001263225.1Re-query CCDS DB by Nucleotide ID:NM_001276296Re-query CCDS DB by Protein ID:NP_001263225Link to BLink:NP_001263225.1
Original member Current member NCBI NM_007904.4 NP_031930.1 Accepted alive Link to Nucleotide Sequence:NM_007904.4Link to Protein Sequence:NP_031930.1Re-query CCDS DB by Nucleotide ID:NM_007904Re-query CCDS DB by Protein ID:NP_031930Link to BLink:NP_031930.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001129533.1 442 P48302 442 100% 0 0
NP_001263225.1 442 P48302 442 100% 0 0
NP_031930.1 442 P48302 442 100% 0 0

Chromosomal Locations for CCDS 27317.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

Chromosome Start Stop Links
14 103817066 103817200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 103819931 103820039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 103820781 103820914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 103821638 103821787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 103823055 103823259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 103823392 103823504 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 103842994 103843476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1329 nt):
ATGCAATCGCCCGCAAGCCGGTGCGGACGCGCCTTGGTGGCGCTGCTGCTGGCCTGTGGCTTCTTGGGGG
TA
TGGGGAGAGAAAAGAGGATTCCCACCTGCCCAAGCCACGCTGTCACTTCTCGGGACTAAAGAGGTAAT
G
ACGCCACCCACTAAGACCTCCTGGACCAGAGGTTCCAACTCCAGTCTGATGCGTTCCTCCGCACCTGCG
GAG
GTGACCAAAGGAGGGAGGGGGGCTGGAGTCCCGCCAAGATCCTTCCCTCCTCCGTGCCAACGAAATA
TT
GAGATCAGCAAGACTTTTAAATACATCAACACGATTGTGTCGTGCCTCGTGTTCGTGCTAGGCATCAT
C
GGGAACTCCACGCTGCTAAGAATCATCTACAAGAACAAGTGCATGCGCAATGGTCCCAATATCTTGATC
GCC
AGTCTGGCTCTGGGAGACCTACTGCACATCATCATAGACATACCCATTAACACCTACAAGTTGCTCG
CA
GAGGACTGGCCATTTGGAGCTGAGATGTGTAAGCTGGTGCCCTTCATACAGAAGGCTTCTGTGGGAAT
C
ACAGTGCTGAGTCTTTGTGCTCTAAGTATTGACAGATATCGAGCTGTTGCTTCTTGGAGTCGAATTAAA
GGA
ATTGGGGTTCCAAAATGGACAGCAGTAGAAATTGTTTTAATTTGGGTGGTCTCTGTGGTTCTGGCTG
TC
CCCGAAGCCATAGGTTTTGATATGATTACGTCGGACTACAAAGGAAAGCCCCTAAGGGTCTGCATGCT
T
AATCCCTTTCAGAAAACAGCCTTCATGCAGTTTTACAAGACAGCCAAAGATTGGTGGCTGTTCAGTTTC
TAC
TTCTGCTTGCCGCTAGCCATCACTGCAGTCTTTTATACCCTGATGACCTGCGAAATGCTCAGGAAGA
AG
AGCGGTATGCAGATTGCTTTGAATGATCACTTAAAGCAGAGACGAGAAGTGGCCAAGACAGTCTTCTG
C
CTGGTCCTCGTGTTTGCTCTCTGTTGGCTTCCCCTTCACCTCAGCCGGATCCTGAAGCTCACCCTGTAT
GAC
CAGAGCAATCCACACAGGTGTGAGCTTCTGAGCTTTTTGTTGGTTTTGGACTACATTGGTATCAACA
TG
GCTTCTTTGAACTCCTGCATCAATCCAATCGCTCTGTATTTGGTGAGCAAAAGATTCAAAAACTGCTT
T
AAGTCATGTTTGTGCTGCTGGTGCCAAACGTTTGAGGAAAAGCAGTCCTTGGAGGAGAAGCAGTCCTGC
CTG
AAGTTCAAAGCCAACGATCACGGATATGACAACTTCCGGTCCAGCAATAAATACAGCTCGTCTTGA


Translation (442 aa):
MQSPASRCGRALVALLLACGFLGVWGEKRGFPPAQATLSLLGTKEVMTPPTKTSWTRGSNSSLMRSSAPA
E
VTKGGRGAGVPPRSFPPPCQRNIEISKTFKYINTIVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILI
A
SLALGDLLHIIIDIPINTYK
LLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIK
G
IGVPKWTAVEIVLIWVVSVVLAVPEAIGFDMITSDYKGKPLRVCMLNPFQKTAFMQ
FYKTAKDWWLFSF
Y
FCLPLAITAVFYTLMTCEMLRKKSGMQIALNDHLKQ
RREVAKTVFCLVLVFALCWLPLHLSRILKLTLY
D
QSNPHRCELL
SFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQTFEEKQSLEEKQSC
L
KFKANDHGYDNFRSSNKYSSS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser