NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27257.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27257.1 Public Mus musculus 14 Hr 16 104 75 CCDS HistoryNCBI Gene:15460Re-query CCDS DB by CCDS ID:27257.1Re-query CCDS DB by GeneID:15460

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27257.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022691 ENSMUSP00000022691 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022691Link to Ensembl Protein Viewer:ENSMUSP00000022691Re-query CCDS DB by Nucleotide ID:ENSMUST00000022691Re-query CCDS DB by Protein ID:ENSMUSP00000022691
Original member Current member EBI,WTSI ENSMUST00000161069 ENSMUSP00000124816 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161069Link to Ensembl Protein Viewer:ENSMUSP00000124816Re-query CCDS DB by Nucleotide ID:ENSMUST00000161069Re-query CCDS DB by Protein ID:ENSMUSP00000124816
Original member Current member EBI,WTSI OTTMUST00000086688 OTTMUSP00000046948 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000086688Link to Vega Protein Viewer:OTTMUSP00000046948Re-query CCDS DB by Nucleotide ID:OTTMUST00000086688Re-query CCDS DB by Protein ID:OTTMUSP00000046948
Original member Current member EBI,WTSI OTTMUST00000086689 OTTMUSP00000046949 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000086689Link to Vega Protein Viewer:OTTMUSP00000046949Re-query CCDS DB by Nucleotide ID:OTTMUST00000086689Re-query CCDS DB by Protein ID:OTTMUSP00000046949
Original member Current member NCBI NM_021877.3 NP_068677.2 Accepted alive Link to Nucleotide Sequence:NM_021877.3Link to Protein Sequence:NP_068677.2Re-query CCDS DB by Nucleotide ID:NM_021877Re-query CCDS DB by Protein ID:NP_068677Link to BLink:NP_068677.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068677.2 1182 Q61645 1182 100% 0 0

Chromosomal Locations for CCDS 27257.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

Chromosome Start Stop Links
14 70556389 70557000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70557629 70558409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70559639 70559789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70559873 70560063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70561812 70561976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70563329 70563418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70563567 70563682 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70565302 70565383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70566029 70566192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70566310 70566546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70566780 70566945 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70567149 70567218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70567502 70567632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70567776 70567895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70567977 70568092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70571378 70571542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70571908 70572036 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 70572242 70572304 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3549 nt):
ATGGAGAGTATGCCCAGCTTCCTGAAGGACACCCCAGCCTGGGAGAAGACAGCCCCTGTGAACGGCATTG
TG
GGACAGGAGCCTGGTACCTCACCACAGGATGGCTTGCGCCATGGGGCACTGTGCCTAGGAGAACCTGC
T
CCCTTTTGGAGGGGTGTTCTGAGCACCCCAGACTCCTGGCTCCCTCCTGGCTTCCTCCAAGGCCCCAAG
GAC
ACACTCTCACTGGTGGAGGGTGAGGGTCCTCGGAACGGGGAGAGGAAGGGCAGCTGGCTAGGCGGCA
AG
GAAGGACTGCGCTGGAAGGAAGCGATGCTGGCCCATCCACTGGCCTTTTGTGGGCCGGCATGCCCACC
T
CGCTATGGGCCCCTGATACCTGAGCATAGTGGTGGCCATCCCAAGAGTGACCCTGTGGCCTTCCGGCCC
TTG
CACTGCCCTTTCCTGCTGGAGACCAAGATTCTAGAGCGAGCTCCCTTCTGGGTTCCTACCTGCTTGC
CT
CCCTACCTGATGTCCAGCCTGCCCCCAGAGCGTCCATATGACTGGCCTTTGGCCCCAAACCCATGGGT
A
TACTCTGGGAGCCAGCCAAAAGTGCCCTCTGCCTTTGGCTTAGGCAGCAAGGGCTTTTACCACAAGGAT
CCG
AACATCCTCAGGCCAGCAAAGGAGCCCTTGGCAGAGTCTGGGATGTTGGGCTTAGCCCCTGGTGGGC
AT
CTCCAGCAAGCCTGTGAATCAGAAGGCCCCTCACTTCACCAGAGGGATGGGGAGACAGGAGCTGGCAG
G
CAGCAGAATCTTTGCCCAGTTTTCTTGGGGTACCCAGACACTGTTCCTCGGGCCCCCTGGCCTTCTTGT
CCC
CCAGGCCTGGTTCACAGTCTTGGCAACATTTGGGCTGGGCCAGGAAGTAATAGCCTTGGGTACCAAC
TA
GGACCACCAGCCACACCAAGGTGCCCATCTCCTGGGCCTCCTACCCCTCCAGGGGGCTGTTGCTCATC
C
CATCTACCTGCCAGAGAGGGGGATCTTGGCCCTTGTAGGAAATGCCAGGATAGCCCAGAGGGAGGTAGC
AGT
GGGCCAGGGGAATCCAGTGAAGAAAGGAACAAAGCTGATTCCAGGGCCTGTCCCCCAAGCCATCACA
CC
AAGCTGAAAAAGACCTGGCTCACACGCCACTCGGAACAGTTTGAGTGCCCAGGTGGCTGTTCAGGGAA
G
GAAGAGAGCCCAGCCACTGGGCTCCGGGCACTCAAGAGGGCAGGCAGTCCAGAGGTCCAAGGAGCATCA
AGG
GGCCCAGCTCCCAAACGCCCATCCCACCCTTTCCCAGGCACTGGGAGGCAGGGGGCCAGGGCTTGGC
AG
GAGACACCGGAGACAATCATAGGAAGCAAGGCGGAGGCAGAGCAACAAGAGGAACAGAGAGGGCCCCG
A
GATGGCAGGATTAGGCTCCAGGAGTCCAGACTTGTGGATACATCCTGCCAGCATCACTTAGCAGGTGTC
ACC
CAGTGCCAAAGCTGTGTCCAGGCAGCTGGAGAGGTAGGGGTACTGACCGGCCACTCCCAGAAATCAC
GT
AGGTCACCCCTGGAGGAGAAGCAGTTGGAGGAGGAGGATTCCTCTGCCACTTCCGAAGAAGGAGGAGG
A
GGGCCTGGCCCAGAAGCTTCACTCAACAAGGGCCTGGCCAAGCACCTGCTGAGTGGTTTGGGGGACCGA
CTC
TGCCGCCTGCTGCGGAAGGAGCGGGAGGCCCTTGCCTGGGCACAGCGAGAAGGCCAGGGGCCAGCCA
TG
ACAGAGGACAGCCCAGGCATTCCACATTGCTGCAGTCGATGCCACCACGGACTCTTCAACACCCACTG
G
AGATGTTCCCACTGTAGCCACCGGCTGTGTGTAGCCTGTGGTCGCATAGCCGGTGCTGGAAAGAACAGG
GAG
AAAACAGGTTCTCAGGAACAGCACACAGATGACTGCGCCCAGGAGGCTGGGCATGCTGCCTGTTCCC
TG
ATCCTGACCCAGTTTGTCTCCAGCCAGGCGCTGGCAGAACTGAGCACTGTGATGCACCAAGTCTGGGC
C
AAGTTTGACATTCGGGGGCACTGTTTCTGCCAGGTTGATGCCCGTGTGTGGGCCCCCGGGGATGGGGGT
CAG
CAGAAGGAACCAACAGAGAAAACTCCCCCAACTCCACAACCTTCCTGCAATGGAGATTCCAATCGGA
CC
AAGGACATCAAAGAAGAGACCCCAGACTCCACTGAGAGCCCAGCAGAGGATGGTGCTGGCCGGTCACC
C
CTTCCTTGTCCCTCTCTCTGTGAGCTGCTAGCCTCTACTGCTGTCAAACTCTGCCTGGGGCATGACCGG
ATT
CACATGGCCTTTGCTCCGGTCACCCCAGCTCTGCCCAGTGATGACCGCATTACCAACATCCTGGACA
GC
ATTATTGCGCAGGTAGTAGAACGGAAGATCCAAGAGAAAGCCCTGGGGCCAGGCCTGCGAGCAGGGTC
A
GGCTTACGCAAGGGCCTGAGCCTTCCATTGTCACCAGTGCGAACCCGGCTGTCTCCTCCTGGAGCTTTG
CTG
TGGCTGCAGGAGCCCAGGCCTAAGCATGGCTTCCATCTCTTCCAGGAACACTGGCGGCAGGGCCAGC
CC
GTGTTAGTGTCAGGCATCCAGAAGACATTGAGACTTAGCCTGTGGGGAATGGAAGCCCTTGGGACACT
T
GGTGGCCAGGTGCAGACACTGACTGCCCTTGGGCCTCCCCAGCCCACAAACCTGGACAGCACAGCATTC
TGG
GAGGGATTCTCTCATCCTGAGACACGTCCAAAGTTAGATGAGGGCTCTGTCCTCCTGCTACACCGAA
CC
CTGGGGGATAAGGACGCTAGCAGGGTGCAGAACCTTGCCTCCAGCCTTCCACTCCCAGAATACTGTGC
C
CACCAAGGGAAACTCAACCTAGCGTCCTACCTCCCCCTGGGCCTCACACTGCATCCACTGGAGCCCCAG
CTC
TGGGCGGCCTATGGTGTGAACTCACACCGTGGACACCTGGGGACCAAGAATCTATGCGTGGAGGTGT
CT
GACCTAATCAGTATCCTGGTGCACGCCGAGGCCCAGCTGCCTCCCTGGTATCGAGCACAGAAAGATTT
C
CTCTCAGGCCTGGATGGGGAAGGACTCTGGTCTCCAGGGAGCCAGACCAGCACTGTGTGGCATGTGTTC
CGG
GCCCAGGATGCCCAGCGCATCCGTCGCTTTCTCCAGATGGTGTGCCCAGCTGGAGCAGGAACCTTGG
AG
CCTGGTGCCCCAGGCAGCTGCTACTTGGATGCAGGGTTGCGCCGACGGCTAAGAGAAGAGTGGGGTGT
G
AGCTGCTGGACCCTGCTGCAGGCTCCTGGGGAAGCGGTGCTGGTCCCGGCTGGGGCGCCCCATCAGGTG
CAG
GGCCTGGTGAGCACAATCAGTGTCACTCAGCACTTTCTGTCTCCTGAGACCTCTGCCCTCTCTGCTC
AG
CTCTACCACCAGGGAGCCAGCCTACCCCCTGACCACCGTATGCTTTATGCCCAGATGGACCGGGCTGT
G
TTCCAAGCAGTAAAGGCGGCTGTGGGGGCGTTACAGGAAGCTAAATAG


Translation (1182 aa):
MESMPSFLKDTPAWEKTAPVNGIVGQEPGTSPQDGLRHGALCLGEPAPFWRGVLSTPDSWLPPGFLQGPK
D
TLSLVEGEGPRNGERKGSWLGGKEGLRWKEAMLAHPLAFCGPACPPRYGPLIPEHSGGHPKSDPVAFRP
L
HCPFLLETKILERAPFWVPTCLPPYLMSSLPPERPYDWPLAPNPWVYSGSQPKVPSAFGLGSK
GFYHKD
P
NILRPAKEPLAESGMLGLAPGGHLQQACESEGPSLHQRDGETGAGRQQNLCPVFLGYPDTVPRAPWPSC
P
PGLVHSLGNIWAGPGSNSLGYQLGPPATPRCPSPGPPTPPGGCCSSHLPAREGDLGPCRKCQDSPEGGS
S
GPGESSEERNKADSRACPPSHHTKLKKTWLTRHSEQFECPGGCSGKEESPATGLRALKRAGSPEVQGAS
R
GPAPKRPSHPFPGTGRQGARAWQETPETIIGSKAEAEQQEEQR
GPRDGRIRLQESRLVDTSCQHHLAGV
T
QCQSCVQAAGEVGVLTGHSQKSR
RSPLEEKQLEEEDSSATSEEGGGGPGPEASLNKGLAKHLLSGLGDR
L
CRLLRKEREALAWAQRE
GQGPAMTEDSPGIPHCCSRCHHGLFNTHWRCSHCSHRLCVACGRIAGAGKNR
E
KT
GSQEQHTDDCAQEAGHAACSLILTQFVSSQALAELSTVMHQVWAKFDIRGHCFCQVDARVWAPGDGG
Q
Q
KEPTEKTPPTPQPSCNGDSNRTKDIKEETPDSTESPAEDGAGRSPLPCPSLCELLASTAVKLCLGHDR
I
HMAFAPVTPALPS
DDRITNILDSIIAQVVERKIQEKALGPGLRAGSGLRKGLSLPLSPVRTRLSPPGAL
L
WLQEPRPKHGFHLFQEHWRQGQ
PVLVSGIQKTLRLSLWGMEALGTLGGQVQTLTALGPPQPTNLDSTAF
W
EGFSHPE
TRPKLDEGSVLLLHRTLGDKDASRVQNLASSLPLPEYCAHQGKLNLASYLPLGLTLHPLEPQ
L
WAAY
GVNSHRGHLGTKNLCVEVSDLISILVHAEAQLPPWYRAQKDFLSGLDGEGLWSPGSQTSTVWHVF
R
AQDAQRIRRFLQM
VCPAGAGTLEPGAPGSCYLDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQV
Q
GLVSTISVTQHFLSPETSALSAQLYHQGASLPPDHRMLYAQ
MDRAVFQAVKAAVGALQEAK



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser