NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27158.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27158.1 Public Mus musculus 14 Lats2 16 104 75 CCDS HistoryNCBI Gene:50523Re-query CCDS DB by CCDS ID:27158.1Re-query CCDS DB by GeneID:50523

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27158.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022531 ENSMUSP00000022531 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022531Link to Ensembl Protein Viewer:ENSMUSP00000022531Re-query CCDS DB by Nucleotide ID:ENSMUST00000022531Re-query CCDS DB by Protein ID:ENSMUSP00000022531
Original member Current member EBI,WTSI OTTMUST00000097026 OTTMUSP00000054318 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000097026Link to Vega Protein Viewer:OTTMUSP00000054318Re-query CCDS DB by Nucleotide ID:OTTMUST00000097026Re-query CCDS DB by Protein ID:OTTMUSP00000054318
Original member Current member NCBI NM_015771.2 NP_056586.2 Accepted alive Link to Nucleotide Sequence:NM_015771.2Link to Protein Sequence:NP_056586.2Re-query CCDS DB by Nucleotide ID:NM_015771Re-query CCDS DB by Protein ID:NP_056586Link to BLink:NP_056586.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056586.2 1042 Q7TSJ6 1042 100% 0 0

Chromosomal Locations for CCDS 27158.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

Chromosome Start Stop Links
14 57691288 57691770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57694314 57694420 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57696120 57696302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57696916 57697498 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57699258 57700558 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57702922 57703054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 57733878 57734216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3129 nt):
ATGAGGCCAAAGACTTTTCCTGCCACAACTTACTCTGGAAATAGCCGGCAGCGATTGCAAGAGATTCGAG
AG
GGGCTGAAGCAGCCATCCAAGGCTTCCACCCAGGGGCTGCTGGTGGGACCAAACAGTGACACTTCCCT
G
GATGCCAAAGTCCTGGGGAGCAAAGATGCCTCCAGGCAGCAGCAAATGAGAGCCACCCCGAAGTTTGGA
CCT
TATCAAAAAGCTCTCAGGGAAATCCGATATTCCCTCCTGCCTTTTGCCAACGAGTCAGGCACTTCGG
CA
GCTGCAGAGGTGAACCGGCAGATGCTTCAGGAGTTGGTGAATGCGGGATGTGACCAGGAGATGGCTGG
C
AGAGCGCTCAAGCAGACGGGCAGTAGGAGTATCGAAGCTGCCTTGGAGTACATCAGTAAGATGGGCTAC
CTG
GACCCCAGGAATGAGCAGATTGTGCGAGTCATCAAGCAGACCTCCCCAGGAAAGGGCCTGGCGCCCA
CC
CCGGTGACTCGGCGGCCCAGTTTCGAGGGCACAGGGGAAGCACTCCCATCCTACCACCAGCTGGGTGG
T
GCAAACTACGAGGGCCCCGCCGCACTGGAGGAGATGCCGCGGCAATATTTAGACTTTCTCTTCCCTGGA
GCC
GGAGCCGGCACCCACGGTGCCCAGGCTCACCAGCATCCTCCCAAAGGGTACAGCACAGCAGTAGAGC
CA
AGTGCGCACTTTCCGGGCACACACTATGGTCGTGGTCATCTACTATCGGAGCAGCCTGGGTATGGGGT
G
CAGCGCAGTTCCTCCTTCCAGAACAAGACGCCACCAGATGCCTATTCCAGCATGGCCAAGGCCCAGGGT
GGC
CCTCCCGCCAGCCTCACCTTTCCTGCCCATGCTGGGCTGTACACTGCCTCGCACCACAAGCCGGCGG
CT
ACCCCACCTGGGGCCCACCCATTACATGTGTTGGGCACCCGGGGTCCCACGTTTACTGGCGAAAGCTC
T
GCACAGGCTGTGCTGGCACCGTCCAGGAACAGCCTCAATGCTGACTTGTACGAGCTGGGCTCCACGGTG
CCC
TGGTCTGCAGCTCCACTGGCACGCCGCGACTCGCTGCAGAAGCAGGGTCTAGAAGCCTCGCGGCCGC
AT
GTGGCTTTTCGGGCTGGCCCCAGCAGGACCAACTCCTTCAACAACCCACAACCTGAGCCCTCACTGCC
C
GCCCCCAACACGGTCACCGCCGTGACGGCCGCACACATCCTTCACCCTGTGAAGAGCGTGCGTGTGCTG
CGG
CCCGAGCCCCAGACAGCCGTGGGGCCCTCGCACCCCGCCTGGGTGGCTGCGCCCACAGCACCTGCCA
CT
GAGAGCCTGGAGACGAAGGAGGGCAGCGCAGGCCCACACCCGCTGGATGTGGACTATGGCGGCTCCGA
G
CGCAGGTGCCCACCGCCTCCGTACCCAAAGCACTTGCTGCTGCCCAGTAAGTCTGAGCAGTACAGCGTG
GAC
CTGGACAGCCTGTGCACCAGTGTGCAGCAGAGTCTGCGAGGGGGCACTGAGCAAGACAGGAGTGACA
AG
AGCCACAAAGGTGCGAAGGGAGACAAAGCTGGCAGAGACAAAAAGCAGATTCAGACCTCCCCGGTGCC
T
GTCCGCAAGAATAGCAGAGATGAAGAGAAGAGAGAGTCTCGCATCAAGAGTTACTCCCCTTATGCCTTC
AAA
TTCTTCATGGAGCAACACGTGGAGAATGTCATCAAAACCTACCAGCAGAAGGTCAGCCGGAGGCTAC
AG
CTGGAGCAGGAAATGGCCAAAGCTGGGCTCTGTGAGGCCGAGCAGGAGCAGATGAGGAAGATCCTCTA
C
CAGAAGGAGTCTAACTACAACCGGCTGAAGAGGGCCAAGATGGACAAGTCCATGTTTGTGAAAATCAAG
ACT
CTAGGCATCGGTGCCTTTGGGGAAGTGTGCCTCGCTTGTAAGCTGGACACTCACGCTCTGTACGCCA
TG
AAGACTCTCAGGAAGAAGGATGTCCTGAACCGGAATCAAGTGGCCCATGTCAAGGCTGAGAGGGACAT
C
CTGGCTGAAGCAGACAATGAGTGGGTGGTCAAACTCTACTACTCCTTCCAGGACAAGGACAGCCTGTAC
TTT
GTGATGGACTACATACCAGGCGGGGATATGATGAGCCTGCTGATCAGGATGGAGGTCTTCCCTGAGC
AC
CTGGCCCGCTTCTACATTGCAGAGTTGACCCTGGCCATTGAAAGTGTCCACAAGATGGGCTTTATCCA
C
CGGGACATCAAGCCTGACAACATACTCATCGACCTGGATGGTCATATTAAGCTGACAGATTTTGGCCTC
TGC
ACTGGATTCAGGTGGACTCACAATTCCAAGTACTACCAGAAAGGGAACCACATGAGACAGGACAGCA
TG
GAGCCCGGTGACCTCTGGGACGATGTTTCCAACTGTCGCTGTGGAGACAGGTTAAAGACCCTGGAGCA
G
AGGGCGCAGAAGCAGCACCAGAGGTGCCTGGCACATTCTCTTGTCGGGACACCAAATTACATCGCTCCG
GAG
GTGCTTCTCCGCAAAGGGTACACGCAGCTCTGTGACTGGTGGAGCGTCGGTGTGATTCTCTTTGAGA
TG
CTGGTTGGGCAGCCGCCTTTCTTGGCCCCCACCCCCACAGAGACGCAGCTGAAGGTGATCAACTGGGA
G
AGCACGCTGCATATCCCTACGCAGGTGAGGCTCAGCGCTGAGGCCCGAGACCTCATCACGAAGCTGTGC
TGC
GCGGCTGACTGCCGCCTGGGCAGGGATGGGGCAGATGACCTCAAGGCACACCCGTTCTTCAACACCA
TC
GACTTTTCCCGTGACATCCGAAAGCAGCCTGCACCCTACGTCCCCACCATCAGCCACCCCATGGACAC
C
TCCAATTTTGACCCGGTGGATGAAGAAAGCCCCTGGCACGAGGCCAGCGGAGAGAGCGCCAAGGCCTGG
GAC
ACGCTGGCCTCCCCCAGCAGCAAGCATCCAGAGCACGCCTTCTATGAGTTCACCTTCCGCAGGTTCT
TC
GATGACAACGGCTATCCCTTCCGGTGCCCGAAGCCCTCAGAGCCCGCAGAGAGTGCAGACCCAGGGGA
T
GCGGACTTGGAAGGTGCGGCCGAGGGCTGCCAGCCGGTGTACGTGTAA


Translation (1042 aa):
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDTSLDAKVLGSKDASRQQQMRATPKFG
P
YQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQ
EMAGRALKQTGSRSIEAALEYISKMGY
L
DPRNEQIVRVIKQTSP
GKGLAPTPVTRRPSFEGTGEALPSYHQLGGANYEGPAALEEMPRQYLDFLFPG
A
GAGTHGAQAHQHPPKGYSTAVEPSAHFPGTHYGRGHLLSEQPGYGVQRSSSFQNKTPPDAYSSMAKAQG
G
PPASLTFPAHAGLYTASHHKPAATPPGAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLNADLYELGSTV
P
WSAAPLARRDSLQKQGLEASRPHVAFRAGPSRTNSFNNPQPEPSLPAPNTVTAVTAAHILHPVKSVRVL
R
PEPQTAVGPSHPAWVAAPTAPATESLETKEGSAGPHPLDVDYGGSERRCPPPPYPKHLLLPSKSEQYSV
D
LDSLCTSVQQSLRGGTEQDRSDKSHKGAKGDKAGRDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAF
K
FFMEQHVENVIKTYQQKVSRRLQLEQEMAK
AGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIK
T
LGIGAFGEVCLACKLDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLY
F
VMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGL
C
TGFRWTHNSKYYQK
GNHMRQDSMEPGDLWDDVSNCRCGDRLKTLEQRAQKQHQRCLAHSLVGTPNYIAP
E
VLLRK
GYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWESTLHIPTQVRLSAEARDLITKLC
C
AADCRLGRDGADDLKAHPFFNTIDFSRDIRKQPAPYVPTISHPMDTSNFDPVDEESPWHEASGESAKAW
D
TLASPSSKHPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAESADPGDADLEGAAEGCQPVYV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser