NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27125.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27125.1 Public Mus musculus 14 Tinf2 16 104 75 CCDS HistoryNCBI Gene:28113Re-query CCDS DB by CCDS ID:27125.1Re-query CCDS DB by GeneID:28113

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27125.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000007733 ENSMUSP00000007733 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000007733Link to Ensembl Protein Viewer:ENSMUSP00000007733Re-query CCDS DB by Nucleotide ID:ENSMUST00000007733Re-query CCDS DB by Protein ID:ENSMUSP00000007733
Original member Current member NCBI NM_145705.3 NP_663751.2 Accepted alive Link to Nucleotide Sequence:NM_145705.3Link to Protein Sequence:NP_663751.2Re-query CCDS DB by Nucleotide ID:NM_145705Re-query CCDS DB by Protein ID:NP_663751Link to BLink:NP_663751.2

Chromosomal Locations for CCDS 27125.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

Chromosome Start Stop Links
14 55679338 55679409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55679514 55679605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55679866 55679930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55680015 55680456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55680611 55680707 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55680795 55680902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55681000 55681089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55681225 55681311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 55681390 55681581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1245 nt):
ATGGCCCCACCTCCAGGGGTAGGTCCCGCGTCTCTGCGGTTTGCTGCCGCCGCCAGCTGGCTGGTAGTCC
GC
CGTCGCCGCGTAGAGCACTTCCCGAAAGTGGTGGAGTTTCTGCAGTCCTTGCGCGCTGCTGCCCCCGG
C
TTGGTTTGCTACCGGCACCATGAACGCCTGTGTATGAGCCTAAAGGCCAAGGTGGTGGTGGAGCTGATC
CTG
CAGGCGCGACCCTGGGACCAGGTCCTGAATGCCCTGAAGCATCACTTCCCAGCAGAGTCCAGAACAA
CA
AAAGAAGACAGGAAGCTTTTGGAGGCACGGGAAAATTTTTGCTTGCTTGTGAAGCACCTGTCAGAGGA
C
CCGCCTTCGAGCCTGCAGGAACTAGAACAAGACTATGGGGAATCCTTTCTAGTTGCCATGGAAAAGCTG
TTG
TTTGAATACTTGTGTCAGCTAGAGAAAGCACTGCCTCCAGTCAGAGCACAAGAGCTTCAGGATGCTC
TA
AGTTGGAGTCAGCCGGGCTCGTTCATCACTTCTTCGGTTGCTTTGCACCAGTATGGTATGGACATGGG
G
TGGACATTTCCAGAGAGCTCTACTTCTGGCTCAGGGAATCTGATAGAGCCCATGGAAGAGAGTCCTCAT
CAG
CAAACCAGGCCAGCATTCCACAGTCCTCTGCCTAAAGCTAAGCTTGGCCCTCACCAGCCAGCTTCAC
TG
GAGCACCCAGAACACTTAGCTGGCCACCGCTTTAATCTGGCCCCTTTGGGAAAGCGAAAATCCCGATC
A
CATTGGACATCGGCAAAGGCGTGCCATAAAGAGCGGCCCACAGTCATGCTACTCCCATTTAGGAACATG
GGC
TTACCAGCTCAAGACTTATCTAACCCTAAAAGCAGGGAAGAACCCGGTGCGGCCTCAGCAGCTTCTG
TG
GGAACAGAGCCAGTCTGCACGGAGGAGGCTAAGACTCCATCTCGGCCTTTGGGGAAAAGGGCATTAGA
G
GAGACCCCACCTGACTCACCGGCTGCAGAGCAGGAGAACAGTGTGAATTGCGTGGATCCTCTAAGACAC
TCA
TCACCGCCTCTTACAGTCAAGAAACCAGTGCTGTCCCCAACCCCGTGTAGCTCTGTTATTACCATAG
GG
GACTTGGTTTTGGACTCTGATGAGGAAGAAAATAACCAGAAGGAAGGGAAGGAGTTTTTGAAAAACTA
C
CAGAAGACGAAGTTTGACACCTATATCCCCATGTTTTGTGACTACATCCCGTAG


Translation (414 aa):
MAPPPGVGPASLRFAAAASWLVVRRRRVEHFPKVVEFLQSLRAAAPGLVCYRHHERLCMSLKAKVVVELI
L
QARPWDQVLNALKHHFPAESRT
TKEDRKLLEARENFCLLVKHLSEDPPSSLQELEQDYGESFLVAMEKL
L
FEYLCQLEKALPPVRAQE
LQDALSWSQPGSFITSSVALHQYGMDMGWTFPESSTSGSGNLIEPMEESPH
Q
QTRPAFHSPLPKAKLGPHQPASLEHPEHLAGHRFNLAPLGKRKSRSHWTSAKACHKERPTVMLLPFRNM
G
LPAQDLSNPKSREEPGAASAASVGTEPVCTEEAKTPSRPLGKRALEETPPDSPAAEQ
ENSVNCVDPLRH
S
SPPLTVKKP
VLSPTPCSSVITIGDLVLDSDEEENNQKEGKEFLKNYQKTKFDTYIPMFCDYIP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser