NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27104.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27104.1 Public Mus musculus 14 Pabpn1 16 104 75 CCDS HistoryNCBI Gene:54196Re-query CCDS DB by CCDS ID:27104.1Re-query CCDS DB by GeneID:54196

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27104.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022808 ENSMUSP00000022808 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022808Link to Ensembl Protein Viewer:ENSMUSP00000022808Re-query CCDS DB by Nucleotide ID:ENSMUST00000022808Re-query CCDS DB by Protein ID:ENSMUSP00000022808
Original member Current member EBI,WTSI OTTMUST00000081722 OTTMUSP00000043753 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081722Link to Vega Protein Viewer:OTTMUSP00000043753Re-query CCDS DB by Nucleotide ID:OTTMUST00000081722Re-query CCDS DB by Protein ID:OTTMUSP00000043753
Original member Current member NCBI NM_019402.2 NP_062275.1 Accepted alive Link to Nucleotide Sequence:NM_019402.2Link to Protein Sequence:NP_062275.1Re-query CCDS DB by Nucleotide ID:NM_019402Re-query CCDS DB by Protein ID:NP_062275Link to BLink:NP_062275.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062275.1 302 Q8CCS6-1 302 100% 0 0

Chromosomal Locations for CCDS 27104.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

Chromosome Start Stop Links
14 54894156 54894494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54894848 54894962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54895629 54895696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54895817 54895923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54896952 54897039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54897121 54897272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54898017 54898056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (909 nt):
ATGGCGGCGGCGGCGGCGGCGGCAGCAGCAGCGGGGGCTGCGGGCGGTCGGGGCTCCGGGCCGGGGCGGC
GG
CGCCATCTTGTGCCCGGGGCCGGTGGGGAGGCCGGGGAGGGGGACCCGGGGGGCGCAGGGGACTACGG
G
AACGGCCTGGAGTCTGAGGAGCTGGAGCCTGGGGAGCTGCTGCCGGAGCCCGAGCCCGAAGAGGAGCCG
CCC
CGGCCCCGCGCCCCTCCGGGAGCTCCGGGTCCTGGGCCCGGCTCGGGAGCCCCCGGCAGTCAGGAGG
AG
GAGGAAGAGCCGGGACTGGTTGAGGCCGACCCCGGCGACGGCGCCATTGAGGACCCGGAGCTAGAAGC
G
ATCAAAGCTCGAGTCAGGGAGATGGAGGAAGAGGCTGAGAAGCTAAAGGAGCTACAAAACGAGGTAGAG
AAG
CAGATGAATATGAGTCCACCCCCAGGCAATGCTGGCCCAGTGATCATGTCTCTTGAGGAGAAGATGG
AG
GCTGATGCCCGCTCTATCTACGTTGGCAATGTGGACTATGGTGCAACAGCAGAAGAGCTGGAAGCCCA
T
TTTCATGGCTGTGGTTCAGTCAACCGTGTTACTATACTCTGTGACAAATTTAGTGGCCATCCCAAAGGG
TTT
GCATATATAGAGTTCTCGGACAAAGAGTCAGTGAGGACGTCCCTGGCCTTAGATGAGTCCCTGTTCA
GA
GGAAGACAAATCAAGGTGATTCCCAAACGAACCAACAGACCAGGCATCAGCACAACAGACCGGGGTTT
C
CCGCGCTCCCGATACCGTGCCCGGACTACCAACTACAACAGCTCCCGATCTCGATTCTACAGTGGTTTT
AAC
AGCAGGCCCCGGGGTCGAATCTACAGGGGCCGGGCTAGAGCGACATCATGGTATTCCCCTTACTAA


Translation (302 aa):
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGDPGGAGDYGNGLESEELEPGELLPEPEPEEEP
P
RPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEADPGDGAIEDP
ELEAIKARVREMEEEAEKLKELQNEVE
K
QMNMSPPPGN
AGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG
F
AYIEFSDKESVRTSLALDESLFRGRQIK
VIPKRTNRPGISTTDRGFPRSRYRARTTNYNSSRSRFYSGF
N
SRPRGRIY
RGRARATSWYSPY



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser