NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27029.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27029.1 Public Mus musculus 14 Pnp 16 104 75 CCDS HistoryNCBI Gene:18950Re-query CCDS DB by CCDS ID:27029.1Re-query CCDS DB by GeneID:18950

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27029.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000048615 ENSMUSP00000043926 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048615Link to Ensembl Protein Viewer:ENSMUSP00000043926Re-query CCDS DB by Nucleotide ID:ENSMUST00000048615Re-query CCDS DB by Protein ID:ENSMUSP00000043926
Original member Current member EBI,WTSI ENSMUST00000178092 ENSMUSP00000136557 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178092Link to Ensembl Protein Viewer:ENSMUSP00000136557Re-query CCDS DB by Nucleotide ID:ENSMUST00000178092Re-query CCDS DB by Protein ID:ENSMUSP00000136557
Original member Current member EBI,WTSI OTTMUST00000080867 OTTMUSP00000043119 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000080867Link to Vega Protein Viewer:OTTMUSP00000043119Re-query CCDS DB by Nucleotide ID:OTTMUST00000080867Re-query CCDS DB by Protein ID:OTTMUSP00000043119
Original member Current member NCBI NM_013632.4 NP_038660.1 Accepted alive Link to Nucleotide Sequence:NM_013632.4Link to Protein Sequence:NP_038660.1Re-query CCDS DB by Nucleotide ID:NM_013632Re-query CCDS DB by Protein ID:NP_038660Link to BLink:NP_038660.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038660.1 289 P23492 289 99.654% 0 1

Chromosomal Locations for CCDS 27029.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

Chromosome Start Stop Links
14 50944583 50944593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50947852 50948021 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50950258 50950361 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50950543 50950718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50950832 50951022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50951404 50951621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (870 nt):
ATGGAGAACGAGTTCACATACGAAGATTATGAGACCACTGCCAAGTGGCTTCTGCAACACACTGAATATC
GA
CCTCAAGTGGCAGTGATCTGTGGTTCCGGCTTAGGAGGGCTGACTGCTCACTTAAAGGAGGCTCAGAT
C
TTTGACTACAATGAGATACCCAACTTTCCCCAAAGCACAGTGCAAGGTCACGCAGGCCGACTGGTGTTT
GGA
TTGCTGAATGGCAGATGCTGTGTGATGATGCAAGGCCGGTTCCATATGTATGAAGGATACTCACTGT
CA
AAGGTGACATTCCCAGTGAGAGTTTTCCATCTTCTGGGTGTGGAAACTTTGGTGGTCACCAATGCTGC
T
GGAGGACTCAACCCCAATTTTGAAGTTGGAGATATTATGCTGATCCGTGATCACATCAACCTACCTGGT
TTC
TGTGGCCAGAACCCTCTCCGGGGCCCCAACGATGAAAGGTTTGGAGTTCGTTTTCCTGCCATGTCTG
AT
GCTTATGACCGGGATATGAGGCAGAAGGCTTTCAGTGCCTGGAAACAAATGGGGGAGCAACGAAAGCT
A
CAAGAAGGCACCTACGTGATGTTGGCAGGCCCCAACTTTGAGACTGTGGCAGAGAGTCGTCTGCTAAAG
ATG
CTGGGGGCAGATGCTGTTGGCATGAGCACAGTCCCAGAAGTTATCGTCGCAAGGCACTGTGGGCTCC
GT
GTCTTTGGTTTCTCACTCATTACGAACAAGGTTGTCATGGATTATGAGAACTTGGAGAAGGCCAATCA
C
ATGGAAGTTCTGGATGCCGGGAAAGCAGCTGCACAGACATTGGAAAGGTTTGTCTCCATTCTTATGGAG
AGC
ATTCCACTCCCGGATCGTGGCAGCTGA


Translation (289 aa):
MENEFTYEDYETTAKWLLQHTEYRPQVAVICGSGLGGLTAHLKEAQIFDYNEIPNFPQSTVQGHAGRLVF
G
LLNGRCCVMMQGRFHMYEGYSLSK
VTFPVRVFHLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPG
F
CGQNPLRGPNDE
RFGVRFPAMSDAYDRDMRQKAFSAWKQMGEQRKLQEGTYVMLAGPNFETVAESRLLK
M
LGADAV
GMSTVPEVIVARHCGLRVFGFSLITNKVVMDYENLEKANHMEVLDAGKAAAQTLERFVSILME
S
IPLPDRGS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser