NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26632.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26632.1 Public Mus musculus 13 Slc6a3 16 104 75 CCDS HistoryNCBI Gene:13162Re-query CCDS DB by CCDS ID:26632.1Re-query CCDS DB by GeneID:13162See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26632.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022100 ENSMUSP00000022100 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022100Link to Ensembl Protein Viewer:ENSMUSP00000022100Re-query CCDS DB by Nucleotide ID:ENSMUST00000022100Re-query CCDS DB by Protein ID:ENSMUSP00000022100
Original member Current member NCBI NM_010020.3 NP_034150.1 Accepted alive Link to Nucleotide Sequence:NM_010020.3Link to Protein Sequence:NP_034150.1Re-query CCDS DB by Nucleotide ID:NM_010020Re-query CCDS DB by Protein ID:NP_034150Link to BLink:NP_034150.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034150.1 619 Q61327 619 100% 0 0

Chromosomal Locations for CCDS 26632.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 73538516 73538801 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73540845 73540976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73544681 73544912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73557042 73557180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73558150 73558284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73560883 73560986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73562301 73562425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73566271 73566383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73567514 73567642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73568185 73568284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73569868 73569968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73571450 73571617 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73572800 73572871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73577210 73577233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1860 nt):
ATGAGTAAAAGCAAATGCTCCGTGGGACCAATGTCTTCTGTGGTGGCCCCGGCTAAAGAGCCCAATGCTG
TG
GGCCCCAGAGAGGTGGAGCTCATCTTGGTCAAGGAGCAGAATGGAGTGCAGCTGACCAACTCCACCCT
C
ATCAACCCACCGCAGACACCAGTGGAGGTTCAAGAGCGGGAGACCTGGAGCAAGAAAATCGATTTCCTG
CTC
TCAGTCATCGGCTTCGCTGTGGACCTGGCCAATGTCTGGAGGTTTCCCTACCTGTGCTACAAAAATG
GT
GGAGGTGCCTTCCTGGTGCCCTACCTGCTCTTCATGGTTATTGCCGGGATGCCCCTCTTCTACATGGA
G
CTGGCTCTCGGGCAGTTCAACAGAGAAGGAGCTGCTGGTGTCTGGAAGATCTGCCCTGTCCTGAAAGGT
GTG
GGCTTCACTGTCATCCTCATCTCTTTCTACGTGGGCTTCTTCTACAATGTCATCATTGCATGGGCAC
TG
CACTACTTCTTCTCCTCCTTCACCATGGACCTCCCATGGATCCACTGCAACAACACCTGGAACAGCCC
C
AACTGCTCTGATGCACATAGCAGCAACTCTAGCGATGGCCTGGGCCTCAACGACACCTTTGGGACCACA
CCC
GCTGCTGAGTATTTTGAGCGTGGTGTGCTGCACCTCCATCAGAGTCGTGGCATTGATGACCTGGGCC
CT
CCACGGTGGCAGCTCACAGCCTGCCTGGTGCTGGTCATTGTTCTGCTCTACTTCAGCCTGTGGAAGGG
A
GTAAAGACTTCAGGGAAGGTGGTGTGGATCACAGCTACCATGCCCTATGTAGTCCTCACAGCCCTGCTC
CTG
CGTGGAGTCACCCTCCCTGGGGCCATGGATGGCATCAGAGCATACCTCAGTGTGGACTTCTACCGTC
TC
TGTGAGGCATCTGTGTGGATCGATGCCGCCACCCAGGTGTGCTTCTCCCTTGGCGTTGGGTTTGGGGT
G
CTGATTGCCTTCTCCAGTTACAATAAGTTCACCAATAACTGCTATAGAGATGCAATCATCACCACCTCC
ATT
AACTCCCTGACGAGCTTCTCCTCTGGCTTCGTTGTCTTCTCCTTCCTGGGGTACATGGCACAGAAGC
AC
AATGTGCCCATCAGGGATGTGGCCACAGATGGACCTGGGTTGATCTTCATCATCTACCCTGAGGCAAT
C
GCCACACTCCCGCTGTCTTCAGCCTGGGCCGCTGTCTTCTTCCTCATGCTGCTCACTCTGGGTATCGAC
AGT
GCCATGGGGGGCATGGAGTCTGTGATCACTGGGCTTGTCGATGAGTTCCAGCTGCTACATCGGCATC
GA
GAGCTCTTCACTCTTGGCATTGTCCTGGCTACTTTCCTGCTGTCTCTCTTCTGTGTCACCAACGGTGG
C
ATCTATGTCTTCACACTGCTGGACCACTTTGCAGCTGGCACATCTATCCTCTTTGGAGTGCTCATTGAA
GCC
ATTGGGGTGGCCTGGTTCTACGGTGTCCAGCAATTCAGTGATGACATCAAGCAGATGACTGGGCAGC
GA
CCCAACCTGTACTGGCGGCTATGCTGGAAGCTGGTCAGCCCCTGCTTCCTTCTGTATGTGGTCGTGGT
C
AGCATTGTGACCTTCAGACCCCCACACTATGGAGCCTACATCTTCCCAGACTGGGCCAATGCCCTGGGC
TGG
ATCATTGCCACATCCTCCATGGCCATGGTGCCCATTTATGCCACCTATAAGTTCTGCAGCCTGCCAG
GG
TCCTTCCGAGAGAAACTGGCCTATGCCATCACACCTGAGAAAGACCGCCAGCTAGTGGACAGAGGGGA
G
GTGCGCCAATTCACGCTGCGCCATTGGCTGTTGGTGTAA


Translation (619 aa):
MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQERETWSKKIDFL
L
SVIGFAVDLANVWRFPYLCYKNGG
GAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPVLKG
V
GFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHCNNTWNSPNCSDAHSSNSSDGLGLNDTFGTT
P
AAEYF
ERGVLHLHQSRGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALL
L
RGVTLPGAMDGIRAYLSVDFYRLCEAS
VWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTS
I
NSLTSFSSGFVVFSFLGYMAQKHNVPIRDVATD
GPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
S
A
MGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIE
A
IGVAWFY
GVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIVTFRPPHYGAYIFPDWANALG
W
IIATSSMAMVPIYATYKFCSLPGSFRE
KLAYAITPEKDRQLVDRGEVRQFTLRHWLLV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser