NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26425.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26425.1 Public Mus musculus 13 Foxc1 16 104 75 CCDS HistoryNCBI Gene:17300Re-query CCDS DB by CCDS ID:26425.1Re-query CCDS DB by GeneID:17300

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26425.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000062292 ENSMUSP00000052196 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000062292Link to Ensembl Protein Viewer:ENSMUSP00000052196Re-query CCDS DB by Nucleotide ID:ENSMUST00000062292Re-query CCDS DB by Protein ID:ENSMUSP00000052196
Original member Current member EBI,WTSI OTTMUST00000001359 OTTMUSP00000000642 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001359Link to Vega Protein Viewer:OTTMUSP00000000642Re-query CCDS DB by Nucleotide ID:OTTMUST00000001359Re-query CCDS DB by Protein ID:OTTMUSP00000000642
Original member Current member NCBI NM_008592.2 NP_032618.2 Accepted alive Link to Nucleotide Sequence:NM_008592.2Link to Protein Sequence:NP_032618.2Re-query CCDS DB by Nucleotide ID:NM_008592Re-query CCDS DB by Protein ID:NP_032618Link to BLink:NP_032618.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032618.2 553 Q61572 553 100% 0 0

Chromosomal Locations for CCDS 26425.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

Chromosome Start Stop Links
13 31807208 31808869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1662 nt):
ATGCAGGCGCGCTACTCGGTGTCCAGCCCCAACTCCCTGGGAGTGGTGCCCTACCTCGGCGGCGAGCAGA
GC
TACTATCGCGCTGCCGCGGCGGCGGCCGGGGGCGGCTACACCGCCATGCCGGCCCCTATGAGCGTGTA
C
TCGCACCCTGCTCACGCCGAGCAGTACCCGGGCAGCATGGCGCGCGCCTACGGGCCTTATACGCCGCAG
CCG
CAGCCCAAGGACATGGTGAAGCCGCCCTACAGCTACATCGCTCTTATCACCATGGCCATCCAGAATG
CC
CCGGACAAGAAGATCACTCTGAATGGCATCTACCAGTTCATCATGGACCGCTTCCCCTTCTATCGGGA
C
AATAAGCAGGGCTGGCAGAACAGCATACGGCACAACCTCTCGCTCAACGAGTGCTTCGTCAAGGTGCCC
CGC
GACGACAAGAAGCCAGGCAAGGGCAGCTACTGGACGCTCGACCCGGACTCCTACAACATGTTCGAGA
AC
GGCAGCTTCCTGCGGCGGCGGCGGCGCTTCAAGAAGAAGGACGCAGTGAAGGACAAGGAGGAGAAGGG
C
CGGCTGCACCTCCAAGAACCGCCACCGCCGCAGGCCGGCCGCCAGCCCGCGCCCGCGCCCCCGGAGCAG
GCC
GAGGGCTCCGCTCCCGGGCCACAGCCGCCGCCCGTGCGCATCCAGGACATCAAGACGGAGAACGGTA
CG
TGTCCCTCGCCTCCCCAGCCCCTGTCCCCGGCTGCCGCCCTAGGCAGCGGCAGCGCCGCCACAGTGCC
C
AAAATCGAGAGCCCCGACAGCAGCAGCAGCAGCTTGTCGAGCGGGAGCAGCCCCCCGGGCAGCCTGCCG
TCG
GCGCGGCCGCTCAGCCTGGACGCTGCAGAACCCGCGCCGCCGCCACAGCCTGCGCCGCCGCCGCATC
AC
AGCCAGGGCTTCAGCGTGGACAACATCATGACGTCGCTGCGGGGGTCGCCGCAGGGTTCGGCCGCTGA
G
CTCGGTTCCGGCCTCCTGGCCTCGGCGGCTGCGTCCTCGCGCGCGGGCATCGCGCCCCCGCTGGCGCTG
GGT
GCCTACTCTCCGGGCCAGAGCTCCCTCTACAGCTCCCCCTGCAGCCAGAGCTCCAGTGCGGGCAGTT
CG
GGCGGCGGGGGTGGCGGCGGCGGCGGAGGCGGCGGCAGCAGCAGCGCTGCGGGTACGGGGGGCGCCGC
C
ACTTACCACTGCAACCTGCAGGCTATGAGCCTGTACGCGGCGGGCGAGCGTGGCGGCCACTTGCAGGGT
CCG
GCGGGAGGCGCGGGCAGCGCGGCGGTGGACGACCCCCTGCCCGACTACTCGCTGCCTCCAGCGACCA
GC
AGCAGCTCTTCGTCCCTGAGTCATGGCGGGGGCGGCCAGGAGGCCAGCCACCACCCTGCATCCCACCA
G
GGCCGACTCACCTCGTGGTACCTGAACCAGGCAGGTGGAGACCTGGGCCACTTGGCGAGCGCGGCGGCG
GCT
GCGGCGGCCGCAGGCTACCCTGGCCAGCAGCAGAACTTCCACTCGGTGCGGGAAATGTTCGAGTCTC
AG
CGGATCGGCTTGAACAACTCCCCGGTGAATGGGAATAGTAGCTGTCAGATGGCTTTCCCTGCCAGTCA
G
TCTCTGTACCGCACGTCGGGGGCTTTCGTCTATGACTGTAGCAAATTCTGA


Translation (553 aa):
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGSMARAYGPYTPQ
P
QPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVP
R
DDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQAGRQPAPAPPEQ
A
EGSAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLP
S
ARPLSLDAAEPAPPPQPAPPPHHSQGFSVDNIMTSLRGSPQGSAAELGSGLLASAAASSRAGIAPPLAL
G
AYSPGQSSLYSSPCSQSSSAGSSGGGGGGGGGGGGSSSAAGTGGAATYHCNLQAMSLYAAGERGGHLQG
P
AGGAGSAAVDDPLPDYSLPPATSSSSSSLSHGGGGQEASHHPASHQGRLTSWYLNQAGGDLGHLASAAA
A
AAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPASQSLYRTSGAFVYDCSKF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser