NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26097.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26097.1 Public Mus musculus 12 Spata7 16 104 75 CCDS HistoryNCBI Gene:104871Re-query CCDS DB by CCDS ID:26097.1Re-query CCDS DB by GeneID:104871See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26097.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000048402 ENSMUSP00000045827 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048402Link to Ensembl Protein Viewer:ENSMUSP00000045827Re-query CCDS DB by Nucleotide ID:ENSMUST00000048402Re-query CCDS DB by Protein ID:ENSMUSP00000045827
Original member Current member EBI,WTSI OTTMUST00000056323 OTTMUSP00000027056 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000056323Link to Vega Protein Viewer:OTTMUSP00000027056Re-query CCDS DB by Nucleotide ID:OTTMUST00000056323Re-query CCDS DB by Protein ID:OTTMUSP00000027056
Original member NCBI NM_178914.3 NP_849245.2 Updated not alive Link to Nucleotide Sequence:NM_178914.3Link to Protein Sequence:NP_849245.2Re-query CCDS DB by Nucleotide ID:NM_178914Re-query CCDS DB by Protein ID:NP_849245
Current member NCBI NM_178914.4 NP_849245.2 Accepted alive Link to Nucleotide Sequence:NM_178914.4Link to Protein Sequence:NP_849245.2Re-query CCDS DB by Nucleotide ID:NM_178914Re-query CCDS DB by Protein ID:NP_849245Link to BLink:NP_849245.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_849245.2 582 Q80VP2 582 100% 0 0

Chromosomal Locations for CCDS 26097.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 98628316 98628334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98631963 98632037 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98634224 98634319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98637566 98637613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98648349 98648482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98658213 98658646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98659550 98659616 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98661972 98662087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98663165 98663218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98664228 98664305 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98668832 98668889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98669102 98669671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1749 nt):
ATGGATGGCAGCCGGAGAGTCAGAGCAACCTCTGTCCTCCCCAGATACAGCCCTCCATGCTTGTTTACAG
GA
CACCTGAGCACCAAGAGCAACGCTTTTTGCACTGATTCCTCTTCTCTCAGACTAAGCACCCTGCAGCT
G
GTCAAGAACCACATGGCTATTCACTATAATAAAATCCTTTCAGCCAAAGCCGCAGTGGACTGCTCAATT
CCA
GTAAGTGTGAATACTAGCATCAAATATGCTGACCAACAACGAAGAGAAAAACTGAGGAAGGAGTTGG
CA
CGGTGTGAAAAGGAGTTTAAATTAAGTAAATCTGCTATGCAGACCAATTCTAAGATGAATTCCAAGTT
C
TTTGTAAATTCTCTACAGAAGCCCTCAGGGGAACCACAAGACCAGGATGTGTTCATAGAAGAAATGACA
AGA
TACCCATCATTTTCAAAGTCACTCATCCCTTCTTCCGAGGGACTGCATCTAAGTCTGCCTGAATCAA
GT
AAGATGCTCATGAGTGGCACCCAGAAGCATGCCAGCACCTCTCCATCCAGACACTCAGGCTGTGGGCA
T
GGCTGCGACAGGCGGCCTCGGAGTGCCCACCAGTTCCAGGTAGCCCTCGCCAAGACCCCAAGTGGAGAT
CTG
TTGGAAAAGCACTCTGACCTCTTCTCTAACAAGCAGTCGCCATTCACTCCACGAACTTTAAAAACAG
AA
GCAAAGTCCTTCCTGTCACAGTACCGCTACTACACACCTGCCAAAAGAAGAAAGGATTTTTCAGATCA
G
CGGATGGAAGCTGAAACCCAAACTGAATTAAGCAGCTTTAACTCTGAGCTTGGGACAGCTGAGAAAACG
AGC
TCAAAGGACTCAGAAGTGAACATAAACCAGGTACCTAATTACACGAGAAATGGTGCTGAAGACAAAA
TA
GCTCCTTTACCCTCACAAGGACAAAACTTAGCATGGGACAGTATTCAAGATGGGATTCTGCAGCAGTC
C
TCAGAAAGGGCATCCTGTAAGCTCTCCACAGAGTTTTCTCCAGACAGTAAAATCTACTCTGATGAAGAA
GAG
CTGCTGTACCTGAGTTTCATGGAAAATGTGACGGATGAAATCTTGAAACTTGGTTTATTTTCTAACA
G
G
TTTCTAGAGCGACTGTTTGAGCGACATATAAAGAAAAATAAACATCATTTGGAGGAGGGAAAGATGCG
C
TACCTGCTGCATGGGCTGAAGGTTGACTTAGGCTGCATATCTGAGGAAGACCCAGCAAAGCAAAAACAT
TTC
AGAATGTTGAATCAACTTCATTTTCAAAAGGCTCTGATTTCAAGAGAAAATGAGTTTGTAAGTGATG
AA
GAAACAGTGAGTCACCACGAGCGCCAGCAGTACCAGGAGGCCCTGGACATGCTGTCGGCTGTGCCGAA
G
GACGAAAACAAGATGTTCTCTTTACCGGGCGAATTTTTAATACCCGCCCATAAAGTCAAGCATTCAGAG
GGT
GTTATAATTCAACAGGTCAATGACGAAACAGATAATGAAGCCTCACCCTGGAATGAAAACAATCCAA
GT
GTTTCTGATAGTGTAATAGACCAGGAAACCTCTGTGGATGTCATTGAAGGTGACAGTGACTTTGAAAG
G
GCTGAGACTTCCAGGGAACTCTGTTGTCTGAGCACATCACTGTCCCCATCTGGTCCATTCCCCAGCATC
AAT
GGTGGCAGTAATCATGGTAAGGAATTATCGACTCTACGAATCATGGGAATGAGCATTGAAGACTGA


Translation (582 aa):
MDGSRRVRATSVLPRYSPPCLFTGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAIHYNKILSAKAAVDCSI
P
VSVNTSIK
YADQQRREKLRKELARCEKEFKLSKSAMQTNSKMNSKFFVNSLQKPSGEPQDQDVFIEEMT
R
YPSFSKSLIPSSEGLHLSLPESSKMLMSGTQKHASTSPSRHSGCGHGCDRRPRSAHQFQVALAKTPSGD
L
LEKHSDLFSNKQSPFTPRTLKTEAKSFLSQYRYYTPAKRRKDFSDQRMEAETQTELS
SFNSELGTAEKT
S
SKDSEVNINQ
VPNYTRNGAEDKIAPLPSQGQNLAWDSIQDGILQQSSERASCKLSTEFSPDSKIYSDEE
E
LLYLSFMENVTDEILKLGLFSN
RFLERLFERHIKKNKHHLEEGKMRYLLHGLKVDLGCISEEDPAKQKH
F
RMLNQLHFQKALISRENEFVSDEETVSHHERQQYQEALDMLSAVPKDENKMFSLPGEFLIPAHKVKHSE
G
VIIQQVNDETDNEASPWNENNPSVSDSVIDQETSVDVIEGDSDFERAETSRELCCLSTSLSPSGPFPSI
N
GGSNHGKELSTLRIMGMSIED




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser