NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25409.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25409.1 Public Mus musculus 11 Krt13 16 104 75 CCDS HistoryNCBI Gene:16663Re-query CCDS DB by CCDS ID:25409.1Re-query CCDS DB by GeneID:16663

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25409.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000007275 ENSMUSP00000007275 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000007275Link to Ensembl Protein Viewer:ENSMUSP00000007275Re-query CCDS DB by Nucleotide ID:ENSMUST00000007275Re-query CCDS DB by Protein ID:ENSMUSP00000007275
Original member Current member EBI,WTSI OTTMUST00000004964 OTTMUSP00000002390 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000004964Link to Vega Protein Viewer:OTTMUSP00000002390Re-query CCDS DB by Nucleotide ID:OTTMUST00000004964Re-query CCDS DB by Protein ID:OTTMUSP00000002390
Original member Current member NCBI NM_010662.1 NP_034792.1 Accepted alive Link to Nucleotide Sequence:NM_010662.1Link to Protein Sequence:NP_034792.1Re-query CCDS DB by Nucleotide ID:NM_010662Re-query CCDS DB by Protein ID:NP_034792Link to BLink:NP_034792.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034792.1 437 P08730-1 437 100% 0 0

Chromosomal Locations for CCDS 25409.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 100117596 100117666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100117983 100118005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100118733 100118953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100119044 100119169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100119281 100119442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100119622 100119778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100119973 100120055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 100121025 100121495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1314 nt):
ATGAGCTGCCGCTTCCAGAGTTCCTCCATGAGCTATGGAGGTGGTTTCGGAGCTGGTTCTTGCCAGCTTG
GA
GGAGGCCGTAATATCTCCTCCTGCTCATCTCGGTTTGTCACTGGAGGGTCAGCTGGAGGCTATGGAGG
G
GGCATGAGCTGTGGCTTTGGTGGAGGAGCTGGTGGTGGCTTTGGAGGTGGCTTTGGAGGTGGCTTTGGA
GGT
AGCTATGGCGGAGGTTTTGGCGGTGGCTTTGGTGACTTCGGAGGTGTCGATGGTGGCCTCCTCTCTG
GC
AACGAGAAGATCACCATGCAGAACCTCAATGACCGCCTGGCCAGCTACCTGGATAAGGTGCGCGCCTT
G
GAGGCAGCCAATGCCGACCTGGAGGTGAAGATTCGTGACTGGCATCTGAAACAGAGCCCAGCTAGTCCA
GAG
CGGGACTACAGTGCTTATTATAAGACCATCGAGGAGCTCCGGATCAAGATTCTGGAAGCCACCACGG
AC
AACAACCGGATCATCCTGGAGATTGACAATGCCAGGCTGGCTGCAGATGACTTCAGGCTCAAGTACGA
A
AATGAGCTGACCTTGCGCCAGAGCGTGGAGGCCGACATCAACGGCCTGCGCAGGGTGCTGGATGAGCTG
ACT
CTGGCTAAGACTGACCTGGAAATGCAGATTGAGAGCCTGAATGAAGAACTGGCTTACCTGAAGAAGA
AC
CACGAAGAGGAGATGAAGGAATTCAGCAACCAGGTAGTAGGCCAGGTCAATGTGGAGATGGACGCCAC
C
CCTGGCATTGATCTGACCCGTGTGCTGGCTGAGATGAGGGAGCAGTATGAAGCCCTGGCAGAGAAGAAT
CGG
AGGGATGCTGAGGAATGGTTCCAGACCAAGAGTGCAGAGCTGAACAAGGAAGTATCCTCCAACGCTG
AA
ATGATCCAGACCAGCAAGACAGAGATCACAGAACTCAGGCGCACACTCCAGGGCCTGGAGATTGAGCT
G
CAGTCCCAGCTGAGCATGAAAGCCGGCCTGGAAAGTACGTTGGCAGAGACAGAGTGCCGCTACGCCCTG
CAG
CTGCAACAGATCCAGGGGCTCATCAGCAGCATCGAGGCTCAGCTGAGCGAGCTCCGAAGTGAGATGG
AG
TGCCAGAACCAGGAATACAAGATGCTGTTGGACATCAAAACAAGGCTGGAACAGGAGATCGCCACCTA
C
CGCAGCCTGCTAGAGGGCCAGGATGCTAAGATGACCGGCTTCAACTCCGGAGGAAATAACACTACTACC
TCC
AACGGGTCCCCCTCCTCCAATTCCGGTCGCCCAGATTTCCGAAAGTATTAA


Translation (437 aa):
MSCRFQSSSMSYGGGFGAGSCQLGGGRNISSCSSRFVTGGSAGGYGGGMSCGFGGGAGGGFGGGFGGGFG
G
SYGGGFGGGFGDFGGVDGGLLSGNEKITMQNLNDRLASYLDKVRALEAANADLEVKIRDWHLKQSPASP
E
RDYSAYYKTIEELRIK
ILEATTDNNRIILEIDNARLAADDFRLKYENELTLRQSVEADINGLRRVLDEL
T
LAKTDLEMQIESLNEELAYLKKNHEE
EMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEALAEKN
R
RDAEEWFQTK
SAELNKEVSSNAEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYAL
Q
LQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDA
KMTGFNSGGNNTTT
S
NGSPSSNSGRPDFRKY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser