NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25115.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25115.1 Public Mus musculus 11 Nos2 16 104 75 CCDS HistoryNCBI Gene:18126Re-query CCDS DB by CCDS ID:25115.1Re-query CCDS DB by GeneID:18126

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25115.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000018610 ENSMUSP00000018610 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018610Link to Ensembl Protein Viewer:ENSMUSP00000018610Re-query CCDS DB by Nucleotide ID:ENSMUST00000018610Re-query CCDS DB by Protein ID:ENSMUSP00000018610
Original member Current member EBI,WTSI OTTMUST00000000466 OTTMUSP00000000202 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000000466Link to Vega Protein Viewer:OTTMUSP00000000202Re-query CCDS DB by Nucleotide ID:OTTMUST00000000466Re-query CCDS DB by Protein ID:OTTMUSP00000000202
Original member Current member NCBI NM_010927.3 NP_035057.1 Accepted alive Link to Nucleotide Sequence:NM_010927.3Link to Protein Sequence:NP_035057.1Re-query CCDS DB by Nucleotide ID:NM_010927Re-query CCDS DB by Protein ID:NP_035057Link to BLink:NP_035057.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035057.1 1144 P29477 1144 100% 0 0

Chromosomal Locations for CCDS 25115.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 78922268 78922377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78928574 78928643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78929751 78929870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78931580 78931728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78935352 78935514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78936403 78936494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78937561 78937702 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78937800 78937939 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78939979 78940153 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78940248 78940349 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78944660 78944854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78945232 78945314 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78945639 78945783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78945869 78945973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78947847 78947896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78948213 78948387 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78949083 78949215 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78949614 78949692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78949956 78950137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78951095 78951258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78952803 78953010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78954895 78954982 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78955340 78955461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78956496 78956644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78957410 78957604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 78959654 78959752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3435 nt):
ATGGCTTGCCCCTGGAAGTTTCTCTTCAAAGTCAAATCCTACCAAAGTGACCTGAAAGAGGAAAAGGACA
TT
AACAACAACGTGAAGAAAACCCCTTGTGCTGTTCTCAGCCCAACAATACAAGATGACCCTAAGAGTCA
C
CAAAATGGCTCCCCGCAGCTCCTCACTGGGACAGCACAGAATGTTCCAGAATCCCTGGACAAGCTGCAT
GTG
ACATCGACCCGTCCACAGTATGTGAGGATCAAAAACTGGGGCAGTGGAGAGATTTTGCATGACACTC
TT
CACCACAAGGCCACATCGGATTTCACTTGCAAGTCCAAGTCTTGCTTGGGGTCCATCATGAACCCCAA
G
AGTTTGACCAGAGGACCCAGAGACAAGCCTACCCCTCTGGAGGAGCTCCTGCCTCATGCCATTGAGTTC
ATC
AACCAGTATTATGGCTCCTTTAAAGAGGCAAAAATAGAGGAACATCTGGCCAGGCTGGAAGCTGTAA
CA
AAGGAAATAGAAACAACAGGAACCTACCAGCTCACTCTGGATGAGCTCATCTTTGCCACCAAGATGGC
C
TGGAGGAATGCCCCTCGCTGCATCGGCAGGATCCAGTGGTCCAACCTGCAGGTCTTTGACGCTCGGAAC
TGT
AGCACAGCACAGGAAATGTTTCAGCACATCTGCAGACACATACTTTATGCCACCAACAATGGCAACA
TC
AGGTCGGCCATCACTGTGTTCCCCCAGCGGAGTGACGGCAAACATGACTTCAGGCTCTGGAATTCACA
G
CTCATCCGGTACGCTGGCTACCAGATGCCCGATGGCACCATCAGAGGGGATGCTGCCACCTTGGAGTTC
ACC
CAGTTGTGCATCGACCTAGGCTGGAAGCCCCGCTATGGCCGCTTTGATGTGCTGCCTCTGGTCTTGC
AA
GCTGATGGTCAAGATCCAGAGGTCTTTGAAATCCCTCCTGATCTTGTGTTGGAGGTGACCATGGAGCA
T
CCCAAGTACGAGTGGTTCCAGGAGCTCGGGTTGAAGTGGTATGCACTGCCTGCCGTGGCCAACATGCTA
CTG
GAGGTGGGTGGCCTCGAATTCCCAGCCTGCCCCTTCAATGGTTGGTACATGGGCACCGAGATTGGAG
TT
CGAGACTTCTGTGACACACAGCGCTACAACATCCTGGAGGAAGTGGGCCGAAGGATGGGCCTGGAGAC
C
CACACACTGGCCTCCCTCTGGAAAGACCGGGCTGTCACGGAGATCAATGTGGCTGTGCTCCATAGTTTC
CAG
AAGCAGAATGTGACCATCATGGACCACCACACAGCCTCAGAGTCCTTCATGAAGCACATGCAGAATG
AG
TACCGGGCCCGTGGAGGCTGCCCGGCAGACTGGATTTGGCTGGTCCCTCCAGTGTCTGGGAGCATCAC
C
CCTGTGTTCCACCAGGAGATGTTGAACTATGTCCTATCTCCATTCTACTACTACCAGATCGAGCCCTGG
AAG
ACCCACATCTGGCAGAATGAGAAGCTGAGGCCCAGGAGGAGAGAGATCCGATTTAGAGTCTTGGTGA
A
A
GTGGTGTTCTTTGCTTCCATGCTAATGCGAAAGGTCATGGCTTCACGGGTCAGAGCCACAGTCCTCTT
T
GCTACTGAGACAGGGAAGTCTGAAGCACTAGCCAGGGACCTGGCCACCTTGTTCAGCTACGCCTTCAAC
ACC
AAGGTTGTCTGCATGGACCAGTATAAGGCAAGCACCTTGGAAGAGGAGCAACTACTGCTGGTGGTGA
CA
AGCACATTTGGGAATGGAGACTGTCCCAGCAATGGGCAGACTCTGAAGAAATCTCTGTTCATGCTTAG
A
GAACTCAACCACACCTTCAGGTATGCTGTGTTTGGCCTTGGCTCCAGCATGTACCCTCAGTTCTGCGCC
TTT
GCTCATGACATCGACCAGAAGCTGTCCCACCTGGGAGCCTCTCAGCTTGCCCCAACAGGAGAAGGGG
AC
GAACTCAGTGGGCAGGAGGATGCCTTCCGCAGCTGGGCTGTACAAACCTTCCGGGCAGCCTGTGAGAC
C
TTTGATGTCCGAAGCAAACATCACATTCAGATCCCGAAACGCTTCACTTCCAATGCAACATGGGAGCCA
CAG
CAATATAGGCTCATCCAGAGCCCGGAGCCTTTAGACCTCAACAGAGCCCTCAGCAGCATCCATGCAA
AG
AACGTGTTTACCATGAGGCTGAAATCCCAGCAGAATCTGCAGAGTGAAAAGTCCAGCCGCACCACCCT
C
CTCGTTCAGCTCACCTTCGAGGGCAGCCGAGGGCCCAGCTACCTGCCTGGGGAACACCTGGGGATCTTC
CCA
GGCAACCAGACCGCCCTGGTGCAGGGAATCTTGGAGCGAGTTGTGGATTGTCCTACACCACACCAAA
CT
GTGTGCCTGGAGGTTCTGGATGAGAGCGGCAGCTACTGGGTCAAAGACAAGAGGCTGCCCCCCTGCTC
A
CTCAGCCAAGCCCTCACCTACTTCCTGGACATTACGACCCCTCCCACCCAGCTGCAGCTCCACAAGCTG
GCT
CGCTTTGCCACGGACGAGACGGATAGGCAGAGATTGGAGGCCTTGTGTCAGCCCTCAGAGTACAATG
AC
TGGAAGTTCAGCAACAACCCCACGTTCCTGGAGGTGCTTGAAGAGTTCCCTTCCTTGCATGTGCCCGC
T
GCCTTCCTGCTGTCGCAGCTCCCTATCTTGAAGCCCCGCTACTACTCCATCAGCTCCTCCCAGGACCAC
ACC
CCCTCGGAGGTTCACCTCACTGTGGCCGTGGTCACCTACCGCACCCGAGATGGTCAGGGTCCCCTGC
AC
CATGGTGTCTGCAGCACTTGGATCAGGAACCTGAAGCCCCAGGACCCAGTGCCCTGCTTTGTGCGAAG
T
GTCAGTGGCTTCCAGCTCCCTGAGGACCCCTCCCAGCCTTGCATCCTCATTGGGCCTGGTACGGGCATT
GCT
CCCTTCCGAAGTTTCTGGCAGCAGCGGCTCCATGACTCCCAGCACAAAGGGCTCAAAGGAGGCCGCA
TG
AGCTTGGTGTTTGGGTGCCGGCACCCGGAGGAGGACCACCTCTATCAGGAAGAAATGCAGGAGATGGT
C
CGCAAGAGAGTGCTGTTCCAGGTGCACACAGGCTACTCCCGGCTGCCCGGCAAACCCAAGGTCTACGTT
CAG
GACATCCTGCAAAAGCAGCTGGCCAATGAGGTACTCAGCGTGCTCCACGGGGAGCAGGGCCACCTCT
AC
ATTTGCGGAGATGTGCGCATGGCTCGGGATGTGGCTACCACATTGAAGAAGCTGGTGGCCACCAAGCT
G
AACTTGAGCGAGGAGCAGGTGGAAGACTATTTCTTCCAGCTCAAGAGCCAGAAACGTTATCATGAAGAT
ATC
TTCGGTGCAGTCTTTTCCTATGGGGCAAAAAAGGGCAGCGCCTTGGAGGAGCCCAAAGCCACGAGGC
TC
TGA


Translation (1144 aa):
MACPWKFLFKVKSYQSDLKEEKDINNNVKKTPCAVLSPTIQDDPKSHQNGSPQLLTGTAQNVPESLDKLH
V
TSTRPQYVRIKNWGSGEILHDTLHHKATS
DFTCKSKSCLGSIMNPKSLTRGPRDKPTPLEELLPHAIEF
I
NQYYGSFK
EAKIEEHLARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARN
C
STAQEMFQHICRHILYATNNGNI
RSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEF
T
Q
LCIDLGWKPRYGRFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANML
L
EVGGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILE
EVGRRMGLETHTLASLWKDRAVTEINVAVLHSF
Q
KQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEMLNYVLSPFYYYQIEPW
K
THIWQNEKLRPRRREIRFRVLV
KVVFFASMLMRKVMASRVRATVLFATETGKSEALARDLATLFSYAFN
T
K
VVCMDQYKASTLEEEQLLLVVTSTFGNGDCPSNGQTLKKSLFMLRELNHTFRYAVFGLGSSMYPQFCA
F
AHDIDQKLSHLGASQLAPTGEGDELSGQEDAFRSWAVQTFR
AACETFDVRSKHHIQIPKRFTSNATWEP
Q
QYRLIQSPEPLDLNR
ALSSIHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTFEGSRGPSYLPGEHLGIF
P
GNQTALVQGILERVVDCPTPHQTVCLEVLDES
GSYWVKDKRLPPCSLSQALTYFLDITTPPTQLQLHKL
A
RFATDETDRQRLEALCQ
PSEYNDWKFSNNPTFLEVLEEFPSLHVPAAFLLSQLPILKPRYYSISSSQDH
T
PSEVHLTVAVVTYRTR
DGQGPLHHGVCSTWIRNLKPQDPVPCFVRSVSGFQLPEDPSQPCILIGPGTGI
A
PFRSFWQQRLHDSQHK
GLKGGRMSLVFGCRHPEEDHLYQEEMQEMVRKRVLFQVHTGYSRLPGKPKVYV
Q
DILQKQLANEVLSVLHGEQGHLYICGDVRMARDVATTLKKLVATKLNLSEEQVEDYFFQLK
SQKRYHED
I
FGAVFSYGAKKGSALEEPKATRL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser