NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25066.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25066.1 Public Mus musculus 11 Abr 16 104 75 CCDS HistoryNCBI Gene:109934Re-query CCDS DB by CCDS ID:25066.1Re-query CCDS DB by GeneID:109934See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39


Attributes
Inferred exon combination

Sequence IDs included in CCDS 25066.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000072740 ENSMUSP00000072522 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072740Link to Ensembl Protein Viewer:ENSMUSP00000072522Re-query CCDS DB by Nucleotide ID:ENSMUST00000072740Re-query CCDS DB by Protein ID:ENSMUSP00000072522
Original member Current member EBI,WTSI OTTMUST00000014071 OTTMUSP00000006538 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014071Link to Vega Protein Viewer:OTTMUSP00000006538Re-query CCDS DB by Nucleotide ID:OTTMUST00000014071Re-query CCDS DB by Protein ID:OTTMUSP00000006538
Original member NCBI NM_198895.1 NP_942598.1 Updated not alive Link to Nucleotide Sequence:NM_198895.1Link to Protein Sequence:NP_942598.1Re-query CCDS DB by Nucleotide ID:NM_198895Re-query CCDS DB by Protein ID:NP_942598
Current member NCBI NM_198895.2 NP_942598.1 Accepted alive Link to Nucleotide Sequence:NM_198895.2Link to Protein Sequence:NP_942598.1Re-query CCDS DB by Nucleotide ID:NM_198895Re-query CCDS DB by Protein ID:NP_942598Link to BLink:NP_942598.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_942598.1 859 Q5SSL4-1 859 100% 0 0

Chromosomal Locations for CCDS 25066.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 76419104 76419193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76419735 76419882 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76422153 76422258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76423048 76423182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76424034 76424173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76424914 76425023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76425267 76425326 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76451853 76451984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76452331 76452428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76454516 76454590 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76455609 76455713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76456161 76456236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76456600 76456722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76459181 76459346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76461293 76461414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76463528 76463668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76464238 76464290 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76468716 76468776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76472489 76472596 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76478995 76479180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76486438 76486536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76508888 76509072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 76571031 76571091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2580 nt):
ATGGAGCCGCTTAGCCACCGGGGCCTGCCGCGCCTCTCTTGGATCGACACCCTCTACAGCAACTTCAGCT
AC
GGTGCGGAGGACTACGACGCAGAGGGGCATGAGGAGCAGAAGGGGCCCCCCGAGGGCTCGGAGACCAT
G
CCGTACATCGACGAGTCACCCACCATGTCGCCCCAGCTCAGCGCCCGCAGCCAAGGTGGTGGGGACAGC
GTC
TCGCCCACCCCACCTGAGGGATTGGCACCTGGGGTGGAGGCAGGGAAGGGTCTGGAGATGAGGAAGC
TA
GTCCTCTCTGGGTTTCTGGCCAGTGAAGAGATCTACATTAACCAGCTGGAAGCTCTGTTACTGCCCAT
G
AAACCCCTGAAGGCCACAGCCACCACCTCCCAGCCTGTGCTCACCATCCAACAGATTGAGACCATCTTC
TAC
AAGATCCAGGACATCTACGAGATCCACAAGGAGTTCTACGACAACCTCTGCCCCAAGGTGCAGCAGT
GG
GACAGCCAGGTCACCATGGGCCATCTTTTCCAGAAACTGGCCAGCCAGCTTGGCGTGTACAAAGCATT
T
GTGGATAACTATAAAGTCGCTCTGGAGACAGCCGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAG
ATC
TCTGAGGAACTCAAAGTGAAAGGGCCCAAGGACTCTAAGGACAGCCATACATCAGTCACCATGGAAG
CT
CTGCTGTACAAGCCAATTGACCGAGTCACCCGGAGCACCCTGGTCCTTCACGATCTGTTGAAGCACAC
A
CCCGTGGACCACCCGGACTACCCGCTGCTTCAGGATGCTCTCCGCATCTCCCAGAATTTCCTGTCTAGC
ATT
AACGAGGACATTGATCCTCGCCGGACTGCAGTCACAACCCCCAAGGGAGAGACTCGGCAGCTGGTGA
AG
GACGGCTTCCTGGTGGAAATGTCTGAGAGCTCCCGGAAGCTGCGGCATGTCTTTCTCTTCACAGATGT
T
CTGCTGTGTGCCAAGCTAAAGAAGACCTCAGCAGGAAAGCATCAGCAGTATGACTGTAAGTGGTACATC
CCT
CTGGCTGACTTAGTGTTCCCATCCCCTGAGGAGTCAGAGGCCAGTCCCCAGGTGCACCCCTTCCCAG
AC
CACGAGCTCGAGGACATGAAAACGAAGATCTCTGCCCTCAAGAGTGAGATCCAGAAGGAGAAAGCCAA
C
AAAGGACAGAGCCGAGCCATTGAGCGCCTCAAAAAGAAGATGTTTGAGAATGAGTTCTTACTGCTGCTC
AAT
TCCCCAACGATCCCTTTCCGGATACACAATCGGAATGGAAAGAGTTACCTGTTTCTTCTGTCTTCTG
AC
TATGAGAGGTCGGAGTGGAGAGAAGCGATTCAGAAGCTACAGAAGAAGGATCTCCAGGCCTTTGTCCT
G
AGCTCTGTGGAGCTCCAGGTGCTCACGGGATCCTGTTTCAAGCTTAGGACTGTGCACAACATTCCTGTC
ACC
AGCAATAAAGATGATGATGAGTCTCCAGGACTGTACGGCTTCCTTCATGTCATCGTCCACTCTGCCA
AG
GGCTTTAAACAGTCAGCCAATCTTTACTGTACTCTGGAGGTGGATTCCTTTGGCTATTTTGTCAGCAA
A
GCCAAGACCAGGGTGTTTCGGGACACGACAGAGCCCAAGTGGGATGAGGAGTTTGAGATTGAGCTGGAG
GGT
TCACAGTCCCTGAGGATCCTGTGTTATGAGAAGTGCTACGACAAGACCAAGGTCAACAAAGACAACA
AT
GAGATTGTGGACAAGATCATGGGCAAGGGGCAGATCCAGCTGGATCCACAGACAGTAGAAAGCAAGAA
C
TGGCATACGGACGTGATTGAAATGAATGGGATCAAAGTGGAATTCTCCATGAAATTTACCAGCCGTGAC
ATG
AGCCTGAAGAGGACCCCATCCAAAAAGCAGACAGGCGTCTTTGGAGTGAAGATCAGCGTGGTGACCA
A
G
CGGGAGCGCTCCAAGGTGCCCTACATCGTCCGGCAATGCATAGAAGAGGTGGAGAAGAGGGGCATTGA
G
GAGGTTGGCATCTACAGGATATCAGGGGTGGCCACGGACATCCAGGCCCTGAAGGCTGTCTTTGATGCC
A
AT
AACAAGGACATCCTACTGATGCTGAGCGACATGGACATCAACGCCATCGCTGGGACCCTCAAGCTAT
AC
TTTCGGGAGCTGCCTGAGCCCCTCCTTACAGATAGACTTTATCCAGCCTTCATGGAGGGCATTGCCCT
G
TCAGACCCTGCTGCCAAGGAGAACTGCATGATGCACCTACTCCGCTCCCTGCCTGACCCCAACCTCATC
ACC
TTCCTTTTCCTGCTGGAACACTTGAAAAGGGTTGCTGAGAAGGAGCCCATCAACAAGATGTCACTTC
AC
AACCTTGCCACGGTGTTTGGCCCCACGTTACTGAGACCATCAGAAGTGGAGAGCAAAGCACATCTCAC
A
TCAGCTGCAGACATCTGGTCCCATGATGTCATGGCCCAGGTCCAGGTCCTCCTCTACTACCTGCAGCAT
CCC
CCCATTTCCTTCGCAGAACTGAAGCGGAACACACTGTACTTCTCCACAGACGTGTAG


Translation (859 aa):
MEPLSHRGLPRLSWIDTLYSNFSYGAEDYDAEGHEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDS
V
SPTPPEGLAPG
VEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIF
Y
KIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKL
ASQLGVYKAFVDNYKVALETAEKCSQSNNQFQK
I
SE
ELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSS
I
NEDIDPRRTAVTTPKGE
TRQLVKDGFLVEMSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYI
P
LADLVFPSPEESEASPQVHPFPDHELEDMKTKISALKSEIQKE
KANKGQSRAIERLKKKMFENEFLLLL
N
SPTIPFRIHNRNGK
SYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPV
T
SNKD
DDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELE
G
SQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQ
LDPQTVESKNWHTDVIEMNGIKVEFSMKFTSRD
M
SLKRTPSKKQTGVFGVKISVVT
KRERSKVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDA
N
NKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLI
T
FLFLLEHLK
RVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH
P
PISFAELKRNTLYFSTDV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser