NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24792.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24792.1 Public Mus musculus 11 Myo15 19 105 81 CCDS HistoryNCBI Gene:17910Re-query CCDS DB by CCDS ID:24792.1Re-query CCDS DB by GeneID:17910See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24792.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000071880 ENSMUSP00000071777 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071880Link to Ensembl Protein Viewer:ENSMUSP00000071777Re-query CCDS DB by Nucleotide ID:ENSMUST00000071880Re-query CCDS DB by Protein ID:ENSMUSP00000071777
Original member Current member EBI,WTSI OTTMUST00000012896 OTTMUSP00000005997 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012896Link to Vega Protein Viewer:OTTMUSP00000005997Re-query CCDS DB by Nucleotide ID:OTTMUST00000012896Re-query CCDS DB by Protein ID:OTTMUSP00000005997
Original member Current member NCBI NM_010862.2 NP_034992.2 Accepted alive Link to Nucleotide Sequence:NM_010862.2Link to Protein Sequence:NP_034992.2Re-query CCDS DB by Nucleotide ID:NM_010862Re-query CCDS DB by Protein ID:NP_034992Link to BLink:NP_034992.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034992.2 3511 Q9QZZ4-1 3511 100% 0 0

Chromosomal Locations for CCDS 24792.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 60476416 60479976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60481656 60481738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60482296 60482359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60483037 60483146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60483438 60483512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60483716 60483806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60486893 60486898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60487151 60487254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60487361 60487424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60488216 60488329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60488741 60488902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60491026 60491139 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60491648 60491706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60491788 60491911 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60492557 60492652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60492956 60493087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60493489 60493614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60494159 60494236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60494926 60495074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60495190 60495235 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60495409 60495533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60496062 60496179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60496393 60496568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60496918 60497002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60497523 60497576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60497676 60497757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60497834 60497964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60498354 60498449 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60499325 60499560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60501694 60501857 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60502075 60502147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60502296 60502487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60502774 60502934 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60503035 60503129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60503559 60503679 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60503787 60503854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60504000 60504077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60504241 60504424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60504511 60504643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60504881 60504986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60505116 60505188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60505962 60506083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60506291 60506350 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60506842 60506917 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60507234 60507349 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60507435 60507553 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60508192 60508333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60508890 60509001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60509078 60509152 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60509534 60509712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60509932 60510047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60510227 60510299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60510569 60510641 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60510855 60510928 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60511125 60511207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60514899 60515029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60517148 60517242 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60517461 60517538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60518388 60518484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60520752 60520912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60521626 60521759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60524004 60524137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60524373 60524506 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60526520 60526660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 60527324 60527425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (10536 nt):
ATGGCGGATGAGGAGAAGAAAGCGAAGAAAGGGAAGAAGGGGAAGAAGGCCCCAGAGCCTGAGAAACCCA
AA
CGGAGCCTCAAGGGCACATCTCGGCTCTTCATGGGCTTCCGAGACCGCACGCCCAAGATCTCTAAGAA
A
GGTCAGTTCCGAAGTGCATCAGCCTTCTTCTGGGGCCTCCACACTGGCCCGCAGAAGACCAAGCGCAAG
AAG
AAGGCCCGTACTGTTCTCAAATCCACATCCAAACTCATGACGCAGATGCGGGTGGGCAAAAAGAAGC
GG
GCGATGAAGGGAAAGAAGCCCTCGTTCATGGTGATCCGCTTCCCTGGACGGCGCGGCTATGGCCGCTT
G
AGGCCTCGTGCCCAGTCACTTAGCAAGGCATCCACAGCTATTAACTGGCTGACCAAGAAGTTCCTCCTC
AAG
AAGGCCGAAGAGTCAGGCAGTGAGCAGGCCACAGTGGACGCCTGGCTCCAGCGCTCCAGCTCCCGAG
TT
GGCTCACGTAAGCTGCCCTTCCCGTCGGGTGCTGAGATCCTGCGGCATGGAGGCCGGCTCCGCAGGTT
C
CCCCGCAGTCATAGCATCTACTCCTCCGGAGAGCCCGTGGGCTTCCTGCCCTTTGAGGACGAAGCCCCA
TTT
CGGCACGCAGGCTCCCGCAAGTCATTGTATGGGCTCGAGGGCTTCCAGGACCTGGGTGAATATTACG
AC
TACCATCGGGAAGGCGACGACTACTATGACCAGCAGTCGCTATACCACTACGAGGAGCAGGAGCCCTA
C
TTGGCTGAGTTCGGTGGGTATAGCCCGGCCTGGCCACCCTATGATGACTATGGGTACCCACCCGGAGAC
CCG
TACAACTACTACCACCCTGACTACTACGGTGACACCCTCTACCCTGGCTATGCCTATGGCTATGGCT
AC
GGCTACGATGATTTTGAGCCCCCATATGCGCCCCCATCAGGGTATTCATCGCCTTACAGCTACCATGA
C
AGCTTTGAGAGTGAGGCCTACCCATACAGCTACTACCTGGACCCCTATGCAACTCACCACATGCCCTAT
CCA
CCCTATGACTTTCCATATGACACTCCTTACGACATACCCTACTTTGATCCTTATGGGGTTCCCTATG
CT
GAAGGTGTCTATGGCGGTGGGGCCGAGGCCATCTATCCCCCTGGGATGCCCTATGTCTATCCAGAAGA
G
CCAGCTTTTATGTACCCATGGGTGCCGCCACCCATAATGTCGCCCCACAACCCATATGCCCACCCCATG
GAC
GACATTGCCGAGCTGGAGGAGCCTGAGGAAACAGGTGAAGAACGTCAGAGCACCTCCTTCCGCCTGC
CC
AGTGCCGCCTTCTTCGAGCAACAAGGTATGGACAAACCAGCCAGGTCCAAACTATCCCTCATCCGGAA
G
TTCCGCCTCTTCCCACGGCCTCAGGTGAAGCTGTTTGGGAAAGAGAAGCTAGAGGTGCCCCTGCCACCC
TCC
CTCGACATTCCTCTGCCTTTAGGGGATGCAGAGGGTGAGGAAGAGGAGGAGGAAATGCCCCCAGTGC
CC
ACGATGCCCTACACCCACCCTTACTGGAGCTTCCTCACACCGCGCCAGCGAAACCTACAGCGCGCCCT
G
TCAGCCTTTGGTGCCCGCCAAGGCCTAGGCTTTGGCCCTGAGTTTGGCCACCCAACGCCACGCCCAGCC
ACC
TCACTGGCACGGTTCCTCAAAAAAACACTGTCAGAAAAGAAGCCCATTCCACGGCTCAGGGGCAGCC
AG
AAGGCCCGAGGAGGGCGGCCCCCAGTGAGGGAGGCAGCCTACAAACGCTTTGGCTACAAGCTGGCCGG
C
ATGGACCCCGATCGACCCAACACGCCCATTGTGCTGAGACGAAGTCAGCCACAAGCTCGCAACAACAAC
AAC
TCCCACGGGCCACCGTCACCCAGGCCTGCACCAAGGGCACTCACGCACTGGAGTGCTCTCATCTCTC
CT
CCAATGCCTGCGCCATCTCCCAGCCCCGCCTCTCCATTGACCCCACCCTTCTCTCCAACCTTCTCCCG
G
CCTCCAAGGCTAGCTTCCCCCTATGGCTCCCTCCGCCAGCATCCACCACCCTGGGCTGCCCCAGCTCAT
GTG
CCTTTTCCACCCCAGGCAAATTGGTGGGGCTTTGCTGAACCCCCTGGAACAAGCCCAGAGGTTGCGC
CT
GACCTTCTGGCCTTTCCTGTACCCCGGCCCTCGTTCAGGGCTTCCCGCAGTCGCAGTCGGAGGGCAGC
T
TATGGTTTCCCCAGCCCTTCCCTGATAGGATCCAGGAGAAGGCCCCACCTGCCCTCACCCCAGCCCTCT
CTG
AGGAGCCTTCCAGGTCAGGGCTACCACTCACCACTGGGACCGTTGTCTCCTCAGTTGTCCCTCCGAA
GG
GGTCCTTTCCAGCCACCCTTCCCACCCCCTCCACGCAGACCTCAGTCACTCCGGGAGGCCTTCTCTCT
A
CGTAGAGCCTCTGGGCGCCTGGGCCCACCCCGCTCACCAGTGCTAGGTTCTCCCCGACCACCCTCACCA
CCC
CCACTCCTGAAACACGGCCCCCGGCACCGGTCCCTCAACCTGCCCTCACGCCTTCCACGGACCTGGC
GG
CGCCTCAGCGAGCCTCCTACGCGGGCTGTGAAACCATGGGTACATAGGGCGTACCCCCCACCACCCAG
T
GCCGGGCCCTGGGGGGCATCCACGGGGGCTTTGGAGCAGCAAGAGAACCAACGTGAAGCAGAAGACTCA
GAA
ACACCGTGGACAGTTCCCCCATTGGCCCCCAGCTGGGATGTGGATATGCCTCCCACACAACGCCCAC
CT
TCTCCGTGGCCAGAAGGTATAGGCAGCCTTAGAGGCTTCTCCAGGCCCCCTCCTGTGCCTGAAAATCC
A
TTGCTTGAGCACACAAGCCCTTCATGTGAGCCACAGTCTGAGGACCGAGTCTCTAATTTAACTGGTATC
TTC
CTGGGCCAACACCATGACCCAGGGCCTGGGCAACTCACCAAGTCAGCCGACCCAAGCTTGGAGAAGC
CT
GAAGAAGTGGTCACCCTAGGGGACCCTCAGCCACCAGCTGAGCCTGAGGCCCTGAACCCAACACCTCC
C
AACAAAAATGTTGTCTCGGAGAGGAAGGTTTTACGACTCAGCGCCTCGTACCCACTGGTCACATGTAAG
CAG
GCAAGGGCAACATGGCCACAATGGCACCGCTGGAAGACAGTGTCTAGAACTCCAGCTCCCTTGGCCC
CC
ACCAGAGCCCCAGGGCCCTTGCTCAAGGCTGGTGAGCAGCCCCGGGCAGAACCTGGGCGGTTTGCAGT
T
GTCATGCCTCAGGTGCGTGGGGTAAGCTCCTTCCGGCCAAAAGGGCCTGCTCCTGTGCAGCCTCCAGAG
CAT
CCAGACCAAGACCCAGAGCAGGGCCCAGCCCCCCAAGCCTGTAGTCTACGCTGGCCCCGCCTCTGGC
CA
CCAACAGATGCTCACTGTCTCTGGTCACGAATTCGCACCTACTCCTCTCAATCCCACCTCCGGGGCCA
T
GGAGGTGACTGTCACAAGAGCCTCTGGAAAAAGACTCGCCCCCAAAGCTGGCAGAACAAGATGCACTCC
ATA
CGCAACCTGCCTTCTATGCGGTCCCGTGAGCAGCACAGGGAAGATGGAGTGGAGGACATGACGCAGC
TG
GAAGACCTCCAAGAGACCACTGTGCTAGCCAACCTAAAGACCAGATTTGAGCGAAACCTCATCTATAC
C
TATATTGGCAGTATTCTGGTGTCGGTGAACCCATATCGAATGTTTGCAATCTACGGGCCTGAGCAGGTG
CAG
CAGTACAGTGGGCGTGCCCTAGGAGAAAATCCCCCGCACCTCTTTGCAATTGCTAATCTTGCCTTCG
CC
AAAATGCTTGATGCCAAACAGAACCAGTGTGTCATCATCAGTGGGGAGAGTGGCTCTGGAAAGACTGA
G
GCTACGAAACTGATTCTGCGCTGCCTGGCTGCCATGAACCAGAGACGGGACGTCATGCAGCAGATAAAG
ATC
CTGGAGGCAACGCCTCTCCTGGAGGCCTTTGGTAATGCCAAAACTGTCAGGAATGACAACTCCAGCC
GC
TTTGGGAAGTTTGTGGAAATCTTTCTAGAAGGGGGTGTGATCTGTGGTGCCATAACCTCTCAGTACCT
G
CTGGAGAAGTCAAGGATTGTGTTCCAGGCCAAAAATGAAAGAAATTATCATATTTTCTATGAGCTGCTG
GCT
GGGCTCCCTGCTCAACTAAGGCAGGCCTTCAGCCTGCAGGAGGCTGAGACCTACTACTACCTGAACC
AG
GGCGGGAACTGTGAGATCGCTGGAAAGAGTGACGCAGATGACTTCCGCCGTCTGCTGGCTGCGATGGA
G
GTGCTTGGCTTCACCAGTGAGGACCAGGACAGCATCTTCCGAATCCTAGCCTCCATCTTACACCTGGGC
AAT
GTCTATTTTGAGAAACATGAGACCGATGCCCAGGAGGTGGCCTCGGTGGTGAGCGCCCGGGAGATCC
AG
GCTGTGGCAGAGCTGCTTCAGGTCTCTCCTGAGGGCCTGCAGAAGGCTATCACCTTCAAAGTGACTGA
G
ACAATTCGAGAGAAGATCTTCACACCCCTAACAGTGGAGAGTGCCGTAGATGCCAGGGACGCCATCGCC
AAG
GTCTTGTATGCACTGCTGTTTGGCTGGCTCATCACCAGGGTCAACGCTCTGGTGTCCCCAAAACAAG
AT
ACATTGTCCATCGCCATCTTGGACATATATGGCTTTGAGGACCTGAGCTTCAACAGCTTTGAACAACT
G
TGCATCAACTATGCCAACGAGAACCTTCAGTACCTGTTCAACAAGATCGTCTTCCAGGAGGAGCAGGAG
GAG
TACATCCGGGAGCAGATGGACTGGAGAGAGATTGCCTTTGCTGACAACCAGCCCTGCATCAACCTCA
TC
TCCCTGAAGCCCTACGGCATCCTGCGCATCCTGGATGACCAGTGCTGCTTTCCCCAGGCCACAGACCA
C
ACATTCCTGCAGAAGTGCCACTACCACCATGGCGCCAACCCGCTCTACTCTAAGCCTAAGATGCCACTG
CCA
GAGTTTACCATCAAGCACTATGCAGGCAAGGTCACCTACCAGGTGCACAAGTTCCTGGACAAGAACC
AT
GACCAAGTGCGCCAAGACGTCCTGGACTTGTTTGTGCACAGCCGCACAAGGGTGGTAGCACACCTTTT
C
TCCAGCCACGCTGCGCAGACTGCCCCTCCACGCCTGGGCAAGAGCAGCTCCATTACCCGTCTCTACAAG
GCT
CACACGGTGGCGGCCAAGTTCCAGCAGTCCCTCCTGGACCTGGTGGAAAAGATGGAGAGGTGTAACC
CT
TTGTTCGTGCGCTGCCTGAAGCCCAACCATAAGAAGGAACCTGGTCTCTTTGAGCCAGATGTGATGAT
G
GCACAGTTACGCTATTCAGGGGTTCTGGAGACTGTGAGGATCCGCAAGGAAGGCTTTCCGGTGCGGCTA
CCC
TTCCAGGTGTTTATCGACAGGTACCGGTGCCTGGTGGCCCTCAAGCTCAACGTGCCAGCAGATGGGG
AC
ATGTGTGTGTCATTGCTGAGCCGGCTATGCACGGTCACTCCAGACATGTACCGTGTTGGGATTAGCAA
G
CTCTTCCTCAAGGAGCACCTGCACCAGCTACTGGAGAGCATGCGGGAGCGAGTCCAGAACCGAGCTGCC
CTC
ACCCTGCAGCGCTACCTGCGAGGTTTTTTCATCCAACGGCACTTCCGGTCCTTGCGGCGGAAGATCA
TC
CTACTGCAGAGCAGAGCCCGTGGTTTTCTGGCCAGACAACGCTACCAGCAGATGAGGCAGAGTCTGCT
G
AAGTTCCGTTCCCTGGTGCACACCTACGTGAACCGCCGCCGCTACCTCAAGCTGAGGGCAGAGCAGAGG
CGC
CGGGCACAGGAGGCATGGCTACGTGAGCAGGAGGAGCTGAGCAAGCGTGAAGTGGTCCCAGTGAGAC
AT
CTGGAGGTGCCAGCTGAGGTGGCTGGGCTCCTGCAAGCCGCAGCAGGCCTCAAGCTGTCCAGTGGGCC
C
CGAGTGGCTGTTGTCCGGGCTCCTAGGCTCCAGGCTGAGCCGTGTGTCACACTTCCCCTTGACATCAAC
AAC
TACCCCATGGCCAAGTTCATTCGATGCCACTTCAAGGAACCCTCCTTTGGGATGCTGACAGTGCCCC
TG
AAGATGCCTCTCACACGGCTGCCTGTGGAGCACCACGCAGAAGCCATAAGTGTCTTTAAGCTAATCCT
G
CGTTTCATGGGAGACCCCCACCTGCATGGCACCCAAGAGATGATCTTGGGGAACTACATTGTGCACCAG
GGG
CTGGTGGAGCCAGCTCTGAGGGACGAGATCCTAGCCCAGCTGGCCAACCAGGTGTGGCGCAATCCCA
AT
GCCTACAACTCCAAGCGGGGCTGGTTGCTGTTGGCTGCCTGTCTCAGTGGCTTTGCGCCTTCCCCGCA
C
CTTGACAAGTTCCTCCTCAAGTTTGTATCTGATTATGGACAGAATGGCTTCCAGGCTGTGTGCCAGCAT
CGC
CTCCTGCAGGCGATGGGCTCAGGGGCTGCCCGGACCTTTCCCCCAACTCAGCTGGAGTGGACTGCCA
TT
CAGGAGAAGGCCAGTATGGCTCTAGATGTGAGCTGCTTCAATGGTGACCAGTTCTCCTGTCCGGTCCA
C
ACCTGGAGTACGGGGGAAGCGGTGGCTGGAGACATCCTAAAGCACAGGGGGCTGGCTGATGGTTGGAGG
GGC
TGGACAGTGGCCATGAAGAATGGAGTCCAGTGGGCAGAGCTGGCTGGACATGACTATGTGCTGGACC
TG
GTATCAGACCTGGAACTGCTCAGGGACTTCCCACGACAGAAATCCTACTTCATAGTGGGTGCAGAAGG
G
CCTTTGGCTGGCAGGGGAGACACCAGAGGAGTGTTTGGGAACTGCTGGGACTCAGACGAGGACACACCC
ACA
AGGCCCCAGCCCCAGGACCACGTGGCCAAGATGCCTGACTTGGATGGGTACTGCAGCCACAAAGAGG
AT
GGTACAAATGGAGAAACTGAGGCCCAGAGATGGACATCGAACCGCCAAGCTGTGGACAGCATTGGAGA
G
TCCACTGTGCCCCCCAGGGAGCTGGATGGCTACTTGGACAGTCTCTTCGACCCTGTGCTGGCCTGTGGG
GAT
GCGGACCTGGAGAAGCCGACAGCCATCGCCTACCGCATGAAAGGTGGGGGCCAGCCAGGTGGAGGTG
GT
GGCAGTACTTCTGAAGATACCTCCCGGAGACCCCCGGAACCCAAGCTCAAGCCCATCCCAGGCCTGGA
T
GCCTCCACACTGGCTCTGCAGCAAGCCTTCATCCACAGGCAGGCTGTGCTACTGGCCCGGGAGATGACC
CTG
CAGGCTTTGGCACTTCAGCAGCAGCCTCTGAGTGCAACCTCAAGACCTCAGCTCCCAGAGAGACCCC
TA
GCACCAGAGGCACGGCCGAAGACTGTAGTAGGCACTGGCCCCCCAGCCAAGCCTGTGCTGGTGCGTCC
G
ACTCCACAGTCGTGGGCTCCGGGCTCTGTGGCAAAGGCCCCGAAGATACCTAGCAAGCCCGTGGCTGTC
CCA
ATCCTAGCTCAAGATTGGACTGCTCCAGAATCCATTTCGGCTTCCCCTGAGCTGGTTCGGTATTCCA
CA
CTCAACTCAGAGCACTTCCCACAACCCACACAGCAGATCAGAAGCATCATCAAGCAATACAAACAGCC
A
CCCTGGGCAGGACACCCTGAGGCCCGCAGGACGGATGGTGGAAAGGTCTTCAGGAGGCCACCTGACCCC
CAT
GAGGAGGCCCTAATGATTCTGAAGGGACAGAAGACTCAACTAGCAGTAGTGCCTGGCACTCAGGTGT
CC
AGAGAGGCTGTGGCCATGGTGAAGCCGGTGACCAGTGCTCCAAGGCCATGCATGGGGCCCACTCCAGT
G
CAGCCTTCAAGGTCGCTGGAGCCTCCAGAGGATCCTGTGCAGACACAGCTGCACCGCCTAGTCAACCCC
AAC
TTCTATGGCTACCAGGACATCCCCTGGCGGATCTTCCTGCGCAAGGAGGTATTTTACCCCAAGGACA
AC
TACAGTCACCCTGTGCAGCTAGACCTCCTGTTCCGGCAGATCCTGCATGACACATTCTCCGAGGCTTG
C
CTGCGCATATCTGAGGATGAGCGGCTGCAGATGAAGGCTCTGTTTGCCCAGAACCAGCTGGACACACAG
CGA
CCTCTGGTAACAGAAAGTGTGAAGCGGGCCGCCATCAGCATGGCCCGAGACAGCTGGGAGATCTACT
TC
TCTCGCCTCTTCCCGGCAATGGGCAGTGTTGGCACCGGCGTGCAGATCCTAGCTGTGTCTCACACTGG
C
ATCAAGCTCCTGCAGATGGTCAAGGGCAGCAAGGAGGCCAGCAGGCGGCTCCGCGTCCTGTGTGCATAC
AG
C
TTTGCAGACATCCTGTTTGTAACCATGCCATCTCAGAACATGCTAGAGTTCAATCTGTCCAACGAGA
AG
CTCATCCTCTTCTCAGCCCGGGCGCAGCAGGTCAAGACCCTAGTAGACACCTTCATTCTGGAACTGAA
G
AAGGATTCTGATTATGTTGTGGCAGTGAGGAACTTCCTGTCTGAAGACCCCGAGCTGCTGTCCTTCCAC
AAG
GGTGACATCATCCACCTGCAGAGCCTGGAACCAACTAGAGTGGGCTACAGCGCCGGTTGTGTAGTCC
GC
AAGAAACTGGTGTACCTGGAGGAGCTGAGGCGGAGAGGCCCTGACTTTGGCTGGAGGTTCGGGGCCGT
C
CACGGGCGCGTAGGACGTTTTCCTTCAGAGCTCGTGCAGCCCGCAGCTGCTCCAGACTTCTTGCAGCTC
CCG
GCAGAGCCAGGGCGGGGCCGGGCTGCCGCGGTGGCCGCCGCTGTGGCCTCTGCAGCAGCCGCACAGG
AG
GTGGGGCGCCGGAGAGAGGGTCCCCCAGTCAGGGCGCGTTCCGCTGACAGCGGAGAGGATTCCATAGC
G
CTCCCACCGAGCACAATGCTCGAATTTGCCCAGAAGTATTTCCGAGACCCTCGGAGGCGTCCCCGGGAT
GGC
CTCAAGCTGAAGTCTAAGGAGGATCGGGAGTCCAAAACTCTGGAGGACGTGCTTTGCTTCACTAAGG
TC
CCGATCCAGGAATCCCTCATTGAACTCAGTGACAGCAATCTCAACAAGATGGCGGTTGACATGTTTGT
A
GCTGTGATGAGGTTCATGGGAGATGCCCCACTGAAGGGCCAGAGCGAACTGGATGTTCTCTGCACCCTT
CTG
AAGCTTTGTGGAGACCATGAGGTCATGAGAGATGAATGCTACTGCCAGATTGTGAAGCAGATCACAG
AC
AACAGCAGCCCTAAGCAGGACAGCTGTCAGCGAGGCTGGAGGCTGCTTTACATCATGGCTGCCTACTA
T
AGTTGCTCTGAGGTCTTCTATCCATACCTCATTCGCTTCCTCCAACATGTGAGCTGGACTCCTGGCCTG
CCC
TTCCAAGGGATTGCCAAGGCCTGTGAACAGAACCTGCAGAAGACCTTGCGTTTTGGAGGCCGCCTGG
AG
TTCCCCAGCAATATGGAGCTCCGTGCTATGTTGGCAGGCCGCAGTTCCAAGAGGCAGCTCTTTCTTCT
T
CCAGGAGGCCTTGAACGCCATCTGAAAATCAAAACGTGCACGGTGGCCCTGGATGTCATAGAGGGGCTC
TGT
ACCGAGATGGCCCTGACACGCCCTGAAGCCTTTGATGAGTATGTCATTTTTGTGGTCACCAACCGAG
GC
CAGCACGTGTGTCCACTGAGCTGCCGGGCCTACATACTGGATGTGGCCTCAGAGATGGAGCAGGTGGA
C
GGGGGCTACACACTCTGGTTCCGGCGGGTGCTTTGGGATCAGCCACTGAAGTTTGAGAATGAGCTGTAT
GTG
ACCATGCACTACAATCAGGTTCTGCCTGACTACCTGAAGGGCCTCTTTAGCAGTGTGCCGGCCAGGC
AG
CCCACAGAGCAACAACTACAGCAGGTGTCCAAGTTGGCTTCACTGCAGCACCGAGCCAAGGACCACTT
C
TACCTGCCCAGTGTGCGTGAAGTCCAAGAGTACATCCCAGCCCAGCTCTACCACACCACGGCCGGTGAC
ACC
TGGCTCAACCTGGTTAGCCAACACAGGCAGCAGACTCAGGCGCTCAGTCCCCACCAGGCCCGCGCTC
AG
TTCCTGGGCCTCCTCAGTGCCTTCCCCTTGTTTGGCTCCTCCTTCTTCTTCATCCAGAGCTGCAGCAA
T
GTCTTGGTGCCAGCCCCCTGTATCCTCGCTGTCAACCATAACGGCCTCAACTTCCTCAGCACCAAGACC
CAT
GAGTTGATTGTGAAGATTCCCCTGAAGGAGATCCAGTCCACGTGGACTCAGCAGCCCACAGCCAATT
CC
AGTTACCCGTATGTGGAGATCTCCCTGGGGGATGTGGCAGCCCAGCGGACCATGCAGCTCCAGCTGGA
G
CAGGGTCTGGAGCTGTGTCGCGTGGTGGCTGTGCATGTGGAGTCCATGCTCAGCGCCCGGGAGGAGCGG
CTC
ACACTGCCTCCCAGCGAGATCACCCTCTTGTGA


Translation (3511 aa):
MADEEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGLHTGPQKTKRK
K
KARTVLKSTSKLMTQMRVGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPRAQSLSKASTAINWLTKKFLL
K
KAEESGSEQATVDAWLQRSSSRVGSRKLPFPSGAEILRHGGRLRRFPRSHSIYSSGEPVGFLPFEDEAP
F
RHAGSRKSLYGLEGFQDLGEYYDYHREGDDYYDQQSLYHYEEQEPYLAEFGGYSPAWPPYDDYGYPPGD
P
YNYYHPDYYGDTLYPGYAYGYGYGYDDFEPPYAPPSGYSSPYSYHDSFESEAYPYSYYLDPYATHHMPY
P
PYDFPYDTPYDIPYFDPYGVPYAEGVYGGGAEAIYPPGMPYVYPEEPAFMYPWVPPPIMSPHNPYAHPM
D
DIAELEEPEETGEERQSTSFRLPSAAFFEQQGMDKPARSKLSLIRKFRLFPRPQVKLFGKEKLEVPLPP
S
LDIPLPLGDAEGEEEEEEMPPVPTMPYTHPYWSFLTPRQRNLQRALSAFGARQGLGFGPEFGHPTPRPA
T
SLARFLKKTLSEKKPIPRLRGSQKARGGRPPVREAAYKRFGYKLAGMDPDRPNTPIVLRRSQPQARNNN
N
SHGPPSPRPAPRALTHWSALISPPMPAPSPSPASPLTPPFSPTFSRPPRLASPYGSLRQHPPPWAAPAH
V
PFPPQANWWGFAEPPGTSPEVAPDLLAFPVPRPSFRASRSRSRRAAYGFPSPSLIGSRRRPHLPSPQPS
L
RSLPGQGYHSPLGPLSPQLSLRRGPFQPPFPPPPRRPQSLREAFSLRRASGRLGPPRSPVLGSPRPPSP
P
PLLKHGPRHRSLNLPSRLPRTWRRLSEPPTRAVKPWVHRAYPPPPSAGPWGASTGALEQQENQREAEDS
E
TPWTVPPLAPSWDVDMPPTQRPPSPWPEGIGSLRGFSRPPPVPENPLLEHTSPSCEPQSEDRVSNLTGI
F
LGQHHDPGPGQLTKSADPSLEKPEEVVTLGDPQPPAEPEALNPTPPNKNVVSERKVLRLSASYPLVTCK
Q
ARATWPQWHRWKTVSRTPAPLAPTRAPGPLLKAGEQPRAEPGRFAVVMPQVRGVSSFRPKGPAPVQPPE
H
PDQDPEQGPAPQACSLRWPRLWPPTDAHCLWSRIRTYSSQSHLRGHGGDCHKSLWKKTRPQSWQNK
MHS
I
RNLPSMRSREQHREDGVEDMTQL
EDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQV
Q
QYSGRALGENP
PHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMNQRRDVMQQIK
I
LEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLE
GGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELL
A
GLPAQLRQAFSLQEAETYYYLNQ
GGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILHLG
N
VYFEKHE
TDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIA
K
VLYALLFGWLITRVNALVSPKQDTLSIAILDIYGFE
DLSFNSFEQLCINYANENLQYLFNKIVFQEEQE
E
YIREQMDWREIAFADNQPCINLISLKPYGILRILDDQCCFPQ
ATDHTFLQKCHYHHGANPLYSKPKMPL
P
EFTIKHYAGKVTYQ
VHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLGKSSSITRLYK
A
HTVAAKFQQSLLDLVEKME
RCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRL
P
FQVFID
RYRCLVALKLNVPADGDMCVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESMRERVQNRAA
L
TLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLA
RQRYQQMRQSLLKFRSLVHTYVNRRRYLKLRAEQR
R
RAQEAWLREQE
ELSKREVVPVRHLEVPAEVAGLLQAAAGLKLSSGPRVAVVRAPRLQAEPCVTLPLDIN
N
YPMAKFIRCHFK
EPSFGMLTVPLKMPLTRLPVEHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQ
G
LVEPALRDEILAQLANQVWRNPNAYNSKRGWLLLAACLSGFAPSPHLDKFLL
KFVSDYGQNGFQAVCQH
R
LLQAMGSGAARTFPPTQLEWTAIQEKASMALDVSCFN
GDQFSCPVHTWSTGEAVAGDILKHRGLADGWR
G
WTVAMKNGVQWAELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEGPLAGRGDTR
GVFGNCWDSDEDTP
T
RPQPQDHVAKMPDLDGYCSHKEDGTNGETEAQRWTSNRQ
AVDSIGESTVPPRELDGYLDSLFDPVLACG
D
A
DLEKPTAIAYRMKGGGQPGGGGGSTSEDTSRRPPEPKLKPIPGLDASTLALQQAFIHRQAVLLAREMT
L
QALALQQQPLSATSRPQLPE
RPLAPEARPKTVVGTGPPAKPVLVRPTPQSWAPGSVAKAPKIPSKPVAV
P
ILAQDWTAPES
ISASPELVRYSTLNSEHFPQPTQQIRSIIKQYKQPPWAGHPEARRTDGGKVFRRPPDP
H
EEALMILKGQKTQLAVVPGTQ
VSREAVAMVKPVTSAPRPCMGPTPVQPSRSLEPPEDPVQTQLHRLVNP
N
FYGYQDIPWRIFLRKE
VFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQMKALFAQNQLDTQ
R
PLVTESVKRAAISMARDSWEIYFSRLFPAM
GSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAY
S
FADILFVTMPSQNMLEFNLSNEKLILFSARAQQVKTLVDTFILELKKDSDYVVAVRNFLSEDPELLSFH
K
GDIIHLQSLEPTRV
GYSAGCVVRKKLVYLEELRRRGPDFGWRFGAVHGRVGRFPSELVQPAAAPDFLQL
P
AEPGRGRAAAVAAAVASAAAAQEVGRRRE
GPPVRARSADSGEDSIALPPSTMLEFAQKYFRDPRRRPRD
G
LKLKSKEDRESKTLEDVLCFTK
VPIQESLIELSDSNLNKMAVDMFVAVMRFMGDAPLKGQSELDVLCTL
L
K
LCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLLYIMAAYYSCSEVFYPYLIRFLQHVSWTPGL
P
FQ
GIAKACEQNLQKTLRFGGRLEFPSNMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVIEGL
C
TEMALTRPEAFDEYVIFVVTNR
GQHVCPLSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENELY
V
TMHYNQ
VLPDYLKGLFSSVPARQPTEQQLQQVSKLASLQHRAKDHFYLPSVREVQEYIPAQLYHTTAGD
T
WLNLVSQHRQQTQALSPHQARAQFL
GLLSAFPLFGSSFFFIQSCSNVLVPAPCILAVNHNGLNFLSTKT
H
ELIVKIPLKEIQSTWTQQPTANSSYPYVEISLGDVAAQRTMQLQLEQGLELCRVVAVHVESMLSAREER
L
TLPPSEITLL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser