NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24687.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24687.1 Public Mus musculus 11 Slc22a5 16 104 75 CCDS HistoryNCBI Gene:20520Re-query CCDS DB by CCDS ID:24687.1Re-query CCDS DB by GeneID:20520

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24687.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000019044 ENSMUSP00000019044 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019044Link to Ensembl Protein Viewer:ENSMUSP00000019044Re-query CCDS DB by Nucleotide ID:ENSMUST00000019044Re-query CCDS DB by Protein ID:ENSMUSP00000019044
Original member Current member EBI,WTSI OTTMUST00000012569 OTTMUSP00000005825 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012569Link to Vega Protein Viewer:OTTMUSP00000005825Re-query CCDS DB by Nucleotide ID:OTTMUST00000012569Re-query CCDS DB by Protein ID:OTTMUSP00000005825
Original member Current member NCBI NM_011396.3 NP_035526.1 Accepted alive Link to Nucleotide Sequence:NM_011396.3Link to Protein Sequence:NP_035526.1Re-query CCDS DB by Nucleotide ID:NM_011396Re-query CCDS DB by Protein ID:NP_035526Link to BLink:NP_035526.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035526.1 557 Q9Z0E8 557 100% 0 0

Chromosomal Locations for CCDS 24687.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 53865809 53865896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53866237 53866372 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53867523 53867705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53869222 53869436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53871568 53871668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53873668 53873794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53874935 53875106 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53876009 53876163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53883661 53883764 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 53891147 53891539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1674 nt):
ATGCGGGACTACGACGAGGTGACCGCCTTCCTAGGCGAGTGGGGGCCCTTCCAGCGCCTCATCTTCTTCC
TG
CTCAGCGCCAGCATCATCCCCAATGGCTTCAATGGTATGTCCATCGTGTTCCTGGCGGGGACCCCGGA
G
CACCGTTGCCTTGTGCCTCACACCGTGAACCTGAGCAGCGCGTGGCGCAACCACAGTATCCCGTTGGAG
ACG
AAGGACGGACGACAGGTGCCTCAGAAATGCCGCCGCTACCGACTGGCCACCATCGCCAACTTCTCTG
AG
CTAGGGCTGGAGCCGGGGCGGGACGTGGACCTGGAGCAGCTGGAGCAGGAGAGCTGCCTGGATGGCTG
G
GAGTACGACAAGGACGTCTTCCTGTCCACCATCGTGACAGAGTGGGACCTGGTGTGTAAGGATGACTGG
AAA
GCCCCACTCACCACCTCCTTGTTTTTCGTGGGTGTGCTGATGGGCTCCTTCATTTCAGGACAGCTCT
CA
GACAGGTTTGGTCGCAAGAATGTGCTGTTTTTGACCATGGGCATGCAGACTGGCTTCAGCTTCCTGCA
G
GTCTTCTCTGTGAACTTCGAGATGTTTACAGTGCTTTTTGTCCTTGTTGGCATGGGTCAGATCTCCAAC
TAC
GTGGCAGCATTTGTCCTGGGAACAGAAATTCTTTCCAAGTCAATTCGAATTATATTCGCCACCTTAG
GA
GTTTGCATATTTTATGCGTTTGGCTTCATGGTGCTGCCACTGTTTGCATACTTCATCAGAGACTGGAG
G
ATGCTGCTGCTGGCGCTCACTGTGCCAGGGGTGCTATGTGGGGCTCTCTGGTGGTTCATCCCTGAGTCC
CCA
CGATGGCTCATCTCTCAAGGCCGAATTAAAGAGGCAGAGGTGATCATCCGCAAAGCTGCCAAAATCA
AT
GGGATTGTTGCACCTTCCACTATCTTCGATCCAAGTGAGTTACAAGACTTAAATTCTACGAAGCCTCA
G
TTGCACCACATTTATGATCTGATCCGAACACGGAATATCAGGGTCATCACCATCATGTCTATAATCCTG
TG
G
CTGACCATATCAGTGGGCTATTTTGGACTATCTCTTGACACTCCTAACTTGCATGGGGACATCTATG
TG
AACTGCTTCCTACTGGCGGCTGTTGAAGTCCCAGCCTATGTGCTGGCCTGGCTGTTGTTGCAGTACTT
G
CCCCGGCGATATTCTATCTCGGCTGCCCTTTTCCTGGGTGGCAGTGTCCTTCTCTTCATGCAGCTGGTG
CCT
TCAGAATTGTTTTACTTGTCCACTGCCCTGGTGATGGTGGGGAAGTTTGGAATCACCTCTGCCTACT
CC
ATGGTCTATGTGTACACAGCTGAGCTGTACCCCACTGTGGTCAGAAACATGGGTGTGGGGGTCAGCTC
C
ACAGCATCCCGCCTTGGCAGCATCCTGTCTCCCTACTTTGTTTACCTAGGTGCCTATGATCGCTTCCTG
CCT
TATATTCTCATGGGAAGTCTGACCATCCTGACAGCTATCCTCACCTTGTTCTTCCCTGAGAGCTTTG
GT
GTCCCTCTCCCAGATACCATTGACCAGATGCTAAGGGTCAAAGGAATAAAACAGTGGCAAATCCAAAG
C
CAGACAAGAATGCAAAAAGATGGTGAAGAAAGCCCAACAGTCCTAAAGAGCACAGCCTTCTAA


Translation (557 aa):
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFNGMSIVFLAGTPEHRCLVPHTVNLSSAWRNHSIPLE
T
KDGRQVPQKCRRYRLATIANFSELGLEPGRDVDLEQLEQESCLDGWEYDKDVFLSTIVTE
WDLVCKDDW
K
APLTTSLFFVGVLMGSFISGQLSD
RFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISN
Y
VAAFVL
GTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPES
P
RWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSE
LQDLNSTKPQLHHIYDLIRTRNIRVITIMSIIL
W
LTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISAALFLGGSVLLFMQLV
P
S
ELFYLSTALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFL
P
YILMGSLTILTAILTLFFPESFGVPLPDTIDQMLRVK
GIKQWQIQSQTRMQKDGEESPTVLKSTAF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser