NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24483.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24483.1 Public Mus musculus 11 Bcl11a 16 104 75 CCDS HistoryNCBI Gene:14025Re-query CCDS DB by CCDS ID:24483.1Re-query CCDS DB by GeneID:14025See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24483.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000881 ENSMUSP00000000881 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000881Link to Ensembl Protein Viewer:ENSMUSP00000000881Re-query CCDS DB by Nucleotide ID:ENSMUST00000000881Re-query CCDS DB by Protein ID:ENSMUSP00000000881
Original member Current member EBI,WTSI OTTMUST00000011803 OTTMUSP00000005476 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011803Link to Vega Protein Viewer:OTTMUSP00000005476Re-query CCDS DB by Nucleotide ID:OTTMUST00000011803Re-query CCDS DB by Protein ID:OTTMUSP00000005476
Original member Current member NCBI NM_016707.3 NP_057916.1 Accepted alive Link to Nucleotide Sequence:NM_016707.3Link to Protein Sequence:NP_057916.1Re-query CCDS DB by Nucleotide ID:NM_016707Re-query CCDS DB by Protein ID:NP_057916Link to BLink:NP_057916.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057916.1 773 Q9QYE3-1 773 100% 0 0

Chromosomal Locations for CCDS 24483.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 24078391 24078445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 24085321 24085650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 24158253 24158354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 24163146 24164888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 24172699 24172790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2322 nt):
ATGTCTCGCCGCAAGCAAGGCAAACCCCAGCACTTAAGCAAACGGGAATTCTCGCCCGAACCTCTTGAAG
CC
ATTCTTACAGATGATGAACCAGACCATGGCCCGTTGGGAGCTCCAGAAGGGGACCACGACCTTCTCAC
C
TGTGGGCAGTGCCAGATGAATTTCCCACTGGGGGACATTCTTATTTTTATCGAGCACAAACGGAAACAA
TGC
AATGGCAGCCTCTGCTTAGAAAAAGGTGTGGATAAGCCGCCTTCCCCTTCTCCCATCGAGATGAAAA
AG
GCATCCAATCCTGTGGAGGTTGGCATCCAGGTCACGCCAGAGGATGACGATTGTTTATCAACGTCATC
T
AGAGGAATTTGCCCCAAACAGGAACACATAGCAGATAAACTTCTGCACTGGAGGGGCCTGTCCTCTCCT
CGG
TCTGCACACGGAGCTCTAATCCCCACGCCCGGGATGAGTGCAGAATATGCCCCGCAGGGTATTTGTA
AA
GATGAGCCCAGCAGCTACACATGTACAACTTGCAAACAGCCATTCACCAGTGCATGGTTTCTCTTGCA
A
CACGCACAGAACACTCATGGATTAAGAATCTACTTAGAAAGTGAACACGGAAGTCCCCTGACCCCGCGG
GTT
GGTATCCCTTCAGGACTAGGTGCAGAATGTCCTTCCCAGCCACCTCTCCATGGGATTCATATTGCAG
AC
AATAACCCCTTTAACCTGCTAAGAATACCAGGATCAGTATCGAGAGAGGCTTCCGGCCTGGCAGAAGG
G
CGCTTTCCACCCACTCCCCCCCTGTTTAGTCCACCACCGAGACATCACTTGGACCCCCACCGCATAGAG
CGC
CTGGGGGCGGAAGAGATGGCCCTGGCCACCCATCACCCGAGTGCCTTTGACAGGGTGCTGCGGTTGA
AT
CCAATGGCTATGGAGCCTCCCGCCATGGATTTCTCTAGGAGACTTAGAGAGCTGGCAGGGAACACGTC
T
AGTCCACCGCTGTCCCCAGGCCGGCCCAGTCCTATGCAAAGGTTACTGCAACCATTCCAGCCAGGTAGC
AAG
CCACCCTTCCTGGCGACGCCCCCCCTCCCTCCTCTGCAATCCGCCCCTCCTCCCTCCCAACCCCCGG
TC
AAGTCCAAGTCATGCGAGTTCTGCGGCAAGACGTTCAAATTTCAGAGCAACTTGGTGGTTCACCGACG
C
AGCCATACTGGTGAGAAGCCCTATAAGTGCAACCTGTGCGACCACGCGTGCACACAGGCCAGCAAGCTG
AAG
CGTCACATGAAGACACACATGCACAAATCGTCCCCCATGACAGTCAAGTCCGACGATGGCCTCTCCA
CA
GCCAGCTCCCCGGAACCTGGTACCAGCGACCTGGTGGGCAGCGCCAGCAGTGCGCTCAAGTCAGTGGT
G
GCCAAGTTCAAGAGTGAGAACGACCCCAACTTGATCCCAGAGAACGGGGATGAGGAGGAAGAGGAGGAC
GAC
GAGGAAGAAGAAGAAGAGGAGGAAGAGGAGGAGGAGGAGCTGACGGAGAGCGAGAGGGTGGACTACG
GC
TTCGGGCTGAGCCTGGAGGCTGCACGCCACCATGAGAACAGCTCTCGGGGCGCAGTGGTGGGCGTGGG
C
GACGAGGGCCGCGCCCTGCCCGATGTCATGCAGGGCATGGTGCTCAGCTCCATGCAGCACTTCAGCGAG
GCC
TTCCACCAGGTCCTGGGCGAAAAGCATAAGCGTAGCCACCTGGCCGAGGCCGAGGGCCATAGGGACA
CT
TGTGATGAAGACTCGGTGGCCGGTGAGTCAGACCGCATAGACGATGGCACTGTTAATGGTCGTGGCTG
C
TCCCCCGGCGAATCGGCTTCGGGGGGTCTGTCCAAAAAGCTGCTGCTGGGTAGCCCCAGCTCGCTGAGC
CCC
TTCTCCAAGCGCATCAAGCTGGAGAAGGAGTTTGACCTGCCCCCGGCCGCGATGCCTAACACGGAGA
AC
GTGTATTCGCAGTGGCTCGCTGGCTATGCGGCCTCCAGGCAGCTCAAAGATCCCTTCCTTACTTTCGG
A
GACTCCAGACAATCGCCTTTTGCCTCCTCATCAGAGCACTCCTCGGAGAACGGGAGCTTGCGCTTCTCC
ACA
CCGCCCGGGGAGCTGGACGGAGGGATCTCAGGGCGCAGCGGCACAGGAAGTGGAGGGAGCACGCCCC
AT
ATTAGTGGTCCGGGCCCGGGCAGGCCCAGCTCAAAAGAGGGCAGACGCAGCGACACTTGTCCTTCACA
C
ACCCCCGTTCGGCGTAGTACCCCGCGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCAAGAACC
CTT
AAGTTCTGA


Translation (773 aa):
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ
C
NGSLCLEKGVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIA
DKLLHWRGLSSP
R
SAHGALIPTPGMSAEYAPQGI
CKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR
V
GIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIE
R
LGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGS
K
PPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKL
K
RHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIPENGDEEEEED
D
EEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDEGRALPDVMQGMVLSSMQHFSE
A
FHQVLGEKHKRSHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLS
P
FSKRIKLEKEFDLPPAAMPNTENVYSQWLAGYAASRQLKDPFLTFGDSRQSPFASSSEHSSENGSLRFS
T
PPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDT
CPSHTPVRRSTPRAQDVWQFSDGSSRT
L
KF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser