NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24443.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24443.1 Public Mus musculus 11 Egfr 16 104 75 CCDS HistoryNCBI Gene:13649Re-query CCDS DB by CCDS ID:24443.1Re-query CCDS DB by GeneID:13649

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24443.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020329 ENSMUSP00000020329 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020329Link to Ensembl Protein Viewer:ENSMUSP00000020329Re-query CCDS DB by Nucleotide ID:ENSMUST00000020329Re-query CCDS DB by Protein ID:ENSMUSP00000020329
Original member Current member EBI,WTSI OTTMUST00000011585 OTTMUSP00000005385 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011585Link to Vega Protein Viewer:OTTMUSP00000005385Re-query CCDS DB by Nucleotide ID:OTTMUST00000011585Re-query CCDS DB by Protein ID:OTTMUSP00000005385
Original member Current member NCBI NM_207655.2 NP_997538.1 Accepted alive Link to Nucleotide Sequence:NM_207655.2Link to Protein Sequence:NP_997538.1Re-query CCDS DB by Nucleotide ID:NM_207655Re-query CCDS DB by Protein ID:NP_997538Link to BLink:NP_997538.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_997538.1 1210 Q01279 1210 100% 0 0

Chromosomal Locations for CCDS 24443.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 16752483 16752570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16858896 16859047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16860068 16860251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16862946 16863080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16867231 16867299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16868108 16868226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16869219 16869360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16870976 16871092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16871583 16871709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16871802 16871875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16872846 16872936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16874960 16875159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16878127 16878259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16881464 16881554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16883456 16883613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16887141 16887185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16889913 16890054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16891178 16891300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16893008 16893106 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16896894 16897079 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16904305 16904460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16905348 16905423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16906736 16906882 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16908877 16908974 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16909732 16909899 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16910208 16910255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16910794 16910896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 16911494 16911855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3633 nt):
ATGCGACCCTCAGGGACCGCGAGAACCACACTGCTGGTGTTGCTGACCGCGCTCTGCGCCGCAGGTGGGG
CG
TTGGAGGAAAAGAAAGTCTGCCAAGGCACAAGTAACAGGCTCACCCAACTGGGCACTTTTGAAGACCA
C
TTTCTGAGCCTGCAGAGGATGTACAACAACTGTGAAGTGGTCCTTGGGAACTTGGAAATTACCTATGTG
CAA
AGGAATTACGACCTTTCCTTCTTAAAGACCATCCAGGAGGTGGCCGGCTATGTCCTCATTGCCCTCA
AC
ACCGTGGAGAGAATCCCTTTGGAGAACCTGCAGATCATCAGGGGAAATGCTCTTTATGAAAACACCTA
T
GCCTTAGCCATCCTGTCCAACTATGGGACAAACAGAACTGGGCTTAGGGAACTGCCCATGCGGAACTTA
CAG
GAAATCCTGATTGGTGCTGTGCGATTCAGCAACAACCCCATCCTCTGCAATATGGATACTATCCAGT
GG
AGGGACATCGTCCAAAACGTCTTTATGAGCAACATGTCAATGGACTTACAGAGCCATCCGAGCAGTTG
C
CCCAAATGTGATCCAAGCTGTCCCAATGGAAGCTGCTGGGGAGGAGGAGAGGAGAACTGCCAGAAATTG
ACC
AAAATCATCTGTGCCCAGCAATGTTCCCATCGCTGTCGTGGCAGGTCCCCCAGTGACTGCTGCCACA
AC
CAATGTGCTGCGGGGTGTACAGGGCCCCGAGAGAGTGACTGTCTGGTCTGCCAAAAGTTCCAAGATGA
G
GCCACATGCAAAGACACCTGCCCACCACTCATGCTGTACAACCCCACCACCTATCAGATGGATGTCAAC
CCT
GAAGGGAAGTACAGCTTTGGTGCCACCTGTGTGAAGAAGTGCCCCCGAAACTACGTGGTGACAGATC
AT
GGCTCATGTGTCCGAGCCTGTGGGCCTGACTACTACGAAGTGGAAGAAGATGGCATCCGCAAGTGTAA
A
AAATGTGATGGGCCCTGTCGCAAAGTTTGTAATGGCATAGGCATTGGTGAATTTAAAGACACACTCTCC
ATA
AATGCTACAAACATCAAACACTTCAAATACTGCACTGCCATCAGCGGGGACCTTCACATCCTGCCAG
TG
GCCTTTAAGGGGGATTCTTTCACGCGCACTCCTCCTCTAGACCCACGAGAACTAGAAATTCTAAAAAC
C
GTAAAGGAAATAACAGGCTTTTTGCTGATTCAGGCTTGGCCTGATAACTGGACTGACCTCCATGCTTTC
GAG
AACCTAGAAATAATACGTGGCAGAACAAAGCAACATGGTCAGTTTTCTTTGGCGGTCGTTGGCCTGA
AC
ATCACATCACTGGGGCTGCGTTCCCTCAAGGAGATCAGTGATGGGGATGTGATCATTTCTGGAAACCG
A
AATTTGTGCTACGCAAACACAATAAACTGGAAAAAACTCTTCGGGACACCCAATCAGAAAACCAAAATC
ATG
AACAACAGAGCTGAGAAAGACTGCAAGGCCGTGAACCACGTCTGCAATCCTTTATGCTCCTCGGAAG
GC
TGCTGGGGCCCTGAGCCCAGGGACTGTGTCTCCTGCCAGAATGTGAGCAGAGGCAGGGAGTGCGTGGA
G
AAATGCAACATCCTGGAGGGGGAACCAAGGGAGTTTGTGGAAAATTCTGAATGCATCCAGTGCCATCCA
GAA
TGTCTGCCCCAGGCCATGAACATCACCTGTACAGGCAGGGGACCAGACAACTGCATCCAGTGTGCCC
AC
TACATTGATGGCCCACACTGTGTCAAGACCTGCCCAGCTGGCATCATGGGAGAGAACAACACTCTGGT
C
TGGAAGTATGCAGATGCCAATAATGTCTGCCACCTATGCCACGCCAACTGTACCTATGGATGTGCTGGG
CCA
GGTCTTCAAGGATGTGAAGTGTGGCCATCTGGGCCAAAGATACCATCTATTGCCACTGGGATTGTGG
GT
GGCCTCCTCTTCATAGTGGTGGTGGCCCTTGGGATTGGCCTATTCATGCGAAGACGTCACATTGTTCG
A
AAGCGTACACTACGCCGCCTGCTTCAAGAGAGAGAGCTCGTGGAACCTCTCACACCCAGCGGAGAAGCT
CCA
AACCAAGCCCACTTGAGGATATTAAAGGAAACAGAATTCAAAAAGATCAAAGTTCTGGGTTCGGGAG
CA
TTTGGCACAGTGTATAAGGGTCTCTGGATCCCAGAAGGTGAGAAAGTAAAAATCCCGGTGGCCATCAA
G
GAGTTAAGAGAAGCCACATCTCCAAAAGCCAACAAAGAAATCCTTGACGAAGCCTATGTGATGGCTAGT
GTG
GACAACCCTCATGTATGCCGCCTCCTGGGCATCTGTCTGACCTCCACTGTCCAGCTCATTACACAGC
TC
ATGCCCTACGGTTGCCTCCTGGACTACGTCCGAGAACACAAGGACAACATTGGCTCCCAGTACCTCCT
C
AACTGGTGTGTGCAGATTGCAAAGGGCATGAACTACCTGGAAGATCGGCGTTTGGTGCACCGTGACTTG
GCA
GCCAGGAATGTACTGGTGAAGACACCACAGCATGTCAAGATCACAGATTTTGGGCTGGCCAAACTGC
TT
GGTGCTGAAGAGAAAGAATATCATGCCGAGGGGGGCAAAGTGCCTATCAAGTGGATGGCTTTGGAATC
A
ATTTTACACCGAATTTATACACACCAAAGTGATGTCTGGAGCTATGGTGTCACTGTGTGGGAACTGATG
ACC
TTTGGGTCCAAGCCTTATGATGGAATCCCAGCAAGTGACATCTCATCCATCCTAGAGAAAGGAGAGC
GC
CTTCCACAGCCACCTATCTGCACCATCGATGTCTACATGATCATGGTCAAGTGCTGGATGATAGATGC
T
GATAGCCGCCCAAAGTTCCGAGAGTTGATTCTTGAATTCTCCAAAATGGCCCGAGACCCACAGCGCTAC
CTT
GTTATCCAGGGGGATGAAAGAATGCATTTGCCAAGCCCTACAGACTCCAACTTTTACCGAGCCCTGA
TG
GATGAAGAGGACATGGAGGATGTAGTTGATGCTGATGAGTATCTTATCCCACAGCAAGGCTTCTTCAA
C
AGCCCGTCCACGTCGAGGACTCCCCTCTTGAGTTCTCTGAGTGCAACTAGCAACAATTCCACTGTGGCT
TGC
ATTAATAGAAATGGGAGCTGCCGTGTCAAAGAAGACGCCTTCTTGCAGCGGTACAGCTCCGACCCCA
CA
GGTGCTGTAACAGAGGACAACATAGATGACGCATTCCTCCCTGTACCTGAATATGTAAACCAATCTGT
T
CCCAAGAGGCCAGCAGGCTCTGTGCAGAACCCTGTCTATCACAATCAGCCCCTGCATCCAGCTCCTGGA
AGA
GACCTGCATTATCAAAATCCCCACAGCAATGCAGTGGGCAACCCTGAGTATCTCAACACTGCCCAGC
CT
ACCTGTCTCAGTAGTGGGTTTAACAGCCCTGCACTCTGGATCCAGAAAGGCAGTCACCAAATGAGCCT
A
GACAACCCTGACTACCAGCAGGACTTCTTCCCCAAGGAAACCAAGCCAAATGGCATATTTAAGGGCCCC
ACA
GCTGAAAATGCAGAGTACCTACGGGTGGCACCTCCAAGCAGTGAGTTTATTGGAGCATGA


Translation (1210 aa):
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEVVLGNLEITYV
Q
RNYDLSFLK
TIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALAILSNYGTNRTGLRELPMRNL
Q
EILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKL
T
KIICAQQCSHRCRGRSPSDCCHNQCAAGCTGPRESDCL
VCQKFQDEATCKDTCPPLMLYNPTTYQMDVN
P
EGKYSFGATCVKKCP
RNYVVTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLS
I
NATNIKHFKYCTAISGDLHILPVAFK
GDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
E
NLEIIRGRTKQ
HGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKLFGTPNQKTKI
M
NNRAEKDC
KAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCNILEGEPREFVENSECIQCHP
E
CLPQAMNITCTGR
GPDNCIQCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYGCAG
P
GLQGCEVWPS
GPKIPSIATGIVGGLLFIVVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEA
P
NQAHLRILKETEFKKIKVLGSGAFGTVYK
GLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMAS
V
DNPHVCRLLGICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAK
GMNYLEDRRLVHRDL
A
ARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK
VPIKWMALESILHRIYTHQSDVWSYGVTVWELM
T
FGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVK
CWMIDADSRPKFRELILEFSKMARDPQRY
L
VIQ
GDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVA
C
INRNG
SCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPG
R
DLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGP
T
AENAEYLRVAPPSSEFIGA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser