NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24096.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24096.1 Public Mus musculus 10 Syn3 16 104 75 CCDS HistoryNCBI Gene:27204Re-query CCDS DB by CCDS ID:24096.1Re-query CCDS DB by GeneID:27204See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24096.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000120638 ENSMUSP00000113720 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120638Link to Ensembl Protein Viewer:ENSMUSP00000113720Re-query CCDS DB by Nucleotide ID:ENSMUST00000120638Re-query CCDS DB by Protein ID:ENSMUSP00000113720
Original member Current member EBI,WTSI OTTMUST00000071040 OTTMUSP00000036313 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000071040Link to Vega Protein Viewer:OTTMUSP00000036313Re-query CCDS DB by Nucleotide ID:OTTMUST00000071040Re-query CCDS DB by Protein ID:OTTMUSP00000036313
Original member Current member NCBI NM_013722.3 NP_038750.2 Accepted alive Link to Nucleotide Sequence:NM_013722.3Link to Protein Sequence:NP_038750.2Re-query CCDS DB by Nucleotide ID:NM_013722Re-query CCDS DB by Protein ID:NP_038750Link to BLink:NP_038750.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038750.2 579 Q8JZP2 579 100% 0 0

Chromosomal Locations for CCDS 24096.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 86055532 86055664 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86057371 86057662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86063962 86064049 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86064796 86064930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86069026 86069128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86073226 86073300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86080207 86080349 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86134986 86135048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86351551 86351640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86354346 86354502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86407613 86407704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86448866 86448923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 86466979 86467289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1740 nt):
ATGAACTTCCTCCGGAGGCGGCTGTCTGACAGCAGCTTTGTGGCCAACCTGCCCAATGGCTACATGCCGG
AC
CTGCAGCGCCCAGAGAGCTCCAGTAGCTCTCCAGCATCCCCGGCCACAGAGAGGAGGCACCCCCAGCC
C
CTGGCTGCCTCCTTCTCATCTCCAGGATCCAGCCTGTTCAGCTCCTTCTCCGGTGCCATGAAACAGACC
CCA
CAGGCTCCCTCAGGGCTGATGGAACCACCCACTCCTGTCACACCCGTGGTTCAGAGACCCAGGATCT
TG
TTGGTTATCGATGACGCCCATACAGACTGGTCAAAGTATTTTCATGGGAAGAAAGTGAATGGCGACAT
T
GAGATCCGAGTGGAACAGGCTGAGTTCTCTGAGCTGAACCTGGCTGCTTATGTTACCGGAGGCTGCATG
GTG
GACATGCAAGTTGTGAGAAATGGCACCAAAATTGTGCGGTCCTTCAAACCTGACTTCATCCTGGTCC
GA
CAGCATGCCTACAGCATGGCCCTGGCTGAGGACTACCGGAGCCTGGTCATCGGCCTCCAGTATGGAGG
G
CTTCCTGCTGTCAACTCTCTCTACTCCGTATACAACTTCTGCAGCAAGCCTTGGGTGTTTTCTCAGCTC
ATT
AAGATCTTCCATTCCTTGGGTCCTGAGAAATTTCCACTAGTGGAGCAAACATTTTTCCCCAACCACA
AG
CCAATGCTCACAGCCCCGAACTTCCCCGTGGTGATCAAGCTGGGACATGCCCATGCTGGCATGGGAAA
G
ATCAAAGTAGAAAACCAGCACGACTACCAGGACATCACCAGCGTGGTGGCCATGGCCAAAACCTATGCC
ACC
ACGGAGGCCTTTATTGACTCCAAGTATGACATCCGCATACAGAAGATTGGATCCAACTACAAGGCAT
AC
ATGAGAACCTCCATCTCTGGAAACTGGAAGGCCAATACAGGCTCTGCTATGCTGGAGCAGGTGGCCAT
G
ACAGAAAGGTACAGGCTGTGGGTGGACAGCTGCTCAGAAATGTTCGGCGGCCTAGACATCTGTGCTGTC
AAG
GCTGTCCACAGCAAGGACGGCAGAGATTATATCATCGAGGTCATGGACAGTTCAATGCCCCTGATTG
GA
GAACACGTGGAAGAAGACAAGCAGCTAATGGCTGACCTTGTCGTTTCCAAGATGAGCCAACTCCTGGT
G
CCAGGGGCCACGGTGCCCTCACCTCTGAGACCTTGGGGTCCACAGACTAAACCTGCAAAATCTCCAGGG
CAA
GGCCAGCTAGGACCTCTACTAGGACAGCCCCAGCCAAGGCCACCTCCACAAGGGGGCCCTCGTCAGG
CT
CAGTCTCCTCAGCCTCCCAGATCTAGGAGTCCATCCCAACAGCGACTCTCGCCACAAGGCCAGCAGCC
T
GTGAGTCCCCAGTCAGGCTCTCCACAGCAGCAAAGGTCACCGGGGTCTCCACAGCTATCCCGGGCATCC
GGT
GGCAGTTCTCCAAACCAGGCCTCCAAGCCAAGTGCCAGCCTCAGTTCACACAACCGGCCTCCAGTGC
AG
GGACGCAGCACCTCCCAGCAGGGTGAAGAGCCTCAAAAATCAGCATCACCCCACCCCCACCTCAACAA
A
TCTCAGTCCCTGACTAACAGCCTCAGCACATCAGATACCTCCCATCGAGGGACCCCAAGTGAAGATGAG
GCC
AAGGCTGAGACAATCCGCAACCTGAGGAAGTCCTTCGCCAGTCTCTTCTCTGACTAG


Translation (579 aa):
MNFLRRRLSDSSFVANLPNGYMPDLQRPESSSSSPASPATERRHPQPLAASFSSPGSSLFSSFSGAMKQT
P
QAPSGLMEPPTPVTPVVQRPRILLVIDDAHTD
WSKYFHGKKVNGDIEIRVEQAEFSELNLAAYVTGGCM
V
DMQVVRNGTKIV
RSFKPDFILVRQHAYSMALAEDYRSLVIGLQYGGLPAVNSLYSVYNFCSKPWVFSQL
I
KIFHSLGPEKFPLVEQTFFPNHKPM
LTAPNFPVVIKLGHAHAGMGKIKVENQHDYQDITSVVAMAKTYA
T
TEAFIDSKYDIRIQKIGSNYKAY
MRTSISGNWKANTGSAMLEQVAMTERYRLWVDSCSEMFGGLDICAV
K
AVHSKDGRDYIIE
VMDSSMPLIGEHVEEDKQLMADLVVSKMSQLLVPGATVPSPLRPWGPQTKPAKSPG
Q
GQLGPLLGQPQPRPPPQ
GGPRQAQSPQPPRSRSPSQQRLSPQGQQPVSPQSGSPQQQRSPGSPQLSRAS
G
GSSPNQASKPSASLSSHNRPPVQGRSTSQQGEEPQKSASPHPHL
NKSQSLTNSLSTSDTSHRGTPSEDE
A
KAETIRNLRKSFASLFSD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser