NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24037.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24037.1 Public Mus musculus 10 Lmnb2 16 104 75 CCDS HistoryNCBI Gene:16907Re-query CCDS DB by CCDS ID:24037.1Re-query CCDS DB by GeneID:16907See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 24037.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000179022 ENSMUSP00000136524 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179022Link to Ensembl Protein Viewer:ENSMUSP00000136524Re-query CCDS DB by Nucleotide ID:ENSMUST00000179022Re-query CCDS DB by Protein ID:ENSMUSP00000136524
Original member Current member NCBI NM_010722.5 NP_034852.2 Accepted alive Link to Nucleotide Sequence:NM_010722.5Link to Protein Sequence:NP_034852.2Re-query CCDS DB by Nucleotide ID:NM_010722Re-query CCDS DB by Protein ID:NP_034852Link to BLink:NP_034852.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034852.2 596 P21619-1 596 100% 0 0

Chromosomal Locations for CCDS 24037.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 80902859 80902900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80903212 80903322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80903450 80903569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80903931 80904038 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80904115 80904388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80904553 80904773 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80904886 80905011 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80905081 80905251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80907151 80907276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80907385 80907541 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80909909 80910045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 80917964 80918161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1791 nt):
ATGGCGTCTCTGCCGCCCCACGCGGGGCCCGCCACGCCGCTGTCGCCCACGCGTCTGTCTCGGCTGCAGG
AG
AAGGAGGAGCTCCGTGAGCTCAACGACCGCCTGGCACACTACATCGACCGTGTCCGCGCGCTGGAGCT
G
GAGAATGATAGGTTGCTGCTCCGGATCTCCGAGAAGGAGGAGGTGACCACTCGCGAGGTGAGTGGCATC
AAG
ACCCTGTACGAGTCAGAGCTGGCTGACGCCCGACGGGTACTGGATGAGACGGCCCGTGAACGTGCCC
GG
CTGCAGATTGAAATTGGAAAGGTGCAGGCTGAGCTAGAGGAGGCCAGGAAGAGTGCCAAGAAGCGGGA
A
GGTGAGCTCACAGTGGCCCAGGGCCGAGTGAAGGATCTGGAATCACTGTTTCACCGGAGTGAGGCTGAG
CTG
GCCACAGCCCTCAGTGACAAGCAGGGCCTGGAGACAGAGGTGGCAGAGCTTCGAGCACAGCTGGCCA
AG
GCAGAAGATGGTCATGCTGTGGCCAAGAAGCAGTTGGAGAAGGAGACGCTGATGCGTGTGGACCTGGA
G
AACCGATGCCAGAGCCTGCAGGAGGAGCTGGCTTTCAGCAAGAGTGTGTTTGAGGAGGAGGTACGGGAG
ACC
CGACGGAGGCACGAGCGGCGCTTGGTGGAGGTGGACAGCAGCCGGCAACAGGAATATGACTTCAAGA
TG
GCTCAGGCCCTGGAGGACCTGCGCAGTCAGCACGATGAGCAAGTGCGCCTGTACCGGGTAGAACTGGA
G
CAGACCTACCAGGCCAAGCTGGACAACGCCAAGCTGCTCTCGGACCAGAATGACAAGGCAGCCCATGCA
GCC
CGCGAGGAGCTCAAGGAGGCCCGCATGCGCGTGGAGTCCCTCAGCTACCAGCTTTTAGGCCTCCAAA
AG
CAGGCCAGTGCTGCAGAGAACCACATCCATGAGCTGGAGGAGGCCTTGGCTGGGGAGCGTGACAAGTT
C
CGCAAGATGCTGGACGCTAAGGAACAGGAGATGACGGAGGTGCGGGACGCCATGCAGCAGCAGCTGGCA
GAG
TACCAAGAGCTGCTGGACATTAAGCTGGCCCTGGACATGGAGATAAGCGCCTACCGCAAGCTGCTGG
AG
GGCGAGGAGGAGAGGCTGAAGCTGTCTCCCAGCCCTTCATCACGGATCACCATCTCTCGGGCCACATC
G
AGCAGCAGCAGCAGCAGCGGGGTTGGCATGTCTGTGGGCCAGGGCCGGGGCAAGCGCCGGCGGCTGGAG
ACT
GAGGACACCTCAGGCTCACCCAGCAGGGCTTCCAGAGTGAGCAGCGGCTCCCGCCTGGCTCAGCAGA
CT
GTGGCCACGGGTGTTGTGAACATCGACGAGGTGGACCCAGAGGGCAGGTTCGTGCGCCTTAAGAACTC
T
TCAGACAAGGACCAGTCTTTGGGGAACTGGAGGATCAAGAGACAGGTTCTGGAGGGTGAGGACATTGCC
TAC
AAGTTCACACCCAAGTATGTCCTGCGGGCCGGCCAGACTGTCACGGTGTGGGCAGCTGGCGCAGGGG
CT
ACCCACAGTCCCCCATCAACCCTTGTGTGGAAAAGCCAGACCAACTGGGGCCCTGGGGAGAGCTTCCG
C
ACTGCCCTGGTCAGTGCCGACGGTGAGGAGGTGGCCGTGAAGGCTGCAAAGCACTCATCTGTCCAGGGG
AGG
GAGAACGGGGAAGAGGAGGAAGAGGAAGAGGCAGAATTCGGTGAAGAGGACCTCTTCCACCAGCAGG
GG
GACCCAAGGACTACCTCAAGGGGCTGCCGACTGATGTGA


Translation (596 aa):
MASLPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGI
K
TLYESELADARRVLDETARERARLQIEIGKVQAELEEARK
SAKKREGELTVAQGRVKDLESLFHRSEAE
L
ATALSDKQGLETEVAELRAQLAK
AEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRE
T
RRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAK
LDNAKLLSDQNDKAAHA
A
REELKEARMRVESLSYQLLGLQKQ
ASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLA
E
YQELLDIKLALDMEISAYRKLLEGEEE
RLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLE
T
EDTSGSPSRASRVSSGSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDK
DQSLGNWRIKRQVLEGEDIA
Y
KFTPKYVLRAGQTVT
VWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAVKAAKHSSVQG
R
ENGEEEEEEEAEFGEEDLFHQQ
GDPRTTSRGCRLM



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser