NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23630.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23630.1 Public Mus musculus 9 Ctnnb1 16 104 75 CCDS HistoryNCBI Gene:12387Re-query CCDS DB by CCDS ID:23630.1Re-query CCDS DB by GeneID:12387

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23630.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000007130 ENSMUSP00000007130 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000007130Link to Ensembl Protein Viewer:ENSMUSP00000007130Re-query CCDS DB by Nucleotide ID:ENSMUST00000007130Re-query CCDS DB by Protein ID:ENSMUSP00000007130
Original member Current member EBI,WTSI ENSMUST00000178812 ENSMUSP00000136294 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178812Link to Ensembl Protein Viewer:ENSMUSP00000136294Re-query CCDS DB by Nucleotide ID:ENSMUST00000178812Re-query CCDS DB by Protein ID:ENSMUSP00000136294
Original member Current member EBI,WTSI OTTMUST00000039790 OTTMUSP00000017750 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039790Link to Vega Protein Viewer:OTTMUSP00000017750Re-query CCDS DB by Nucleotide ID:OTTMUST00000039790Re-query CCDS DB by Protein ID:OTTMUSP00000017750
Original member Current member NCBI NM_001165902.1 NP_001159374.1 Accepted alive Link to Nucleotide Sequence:NM_001165902.1Link to Protein Sequence:NP_001159374.1Re-query CCDS DB by Nucleotide ID:NM_001165902Re-query CCDS DB by Protein ID:NP_001159374Link to BLink:NP_001159374.1
Original member Current member NCBI NM_007614.3 NP_031640.1 Accepted alive Link to Nucleotide Sequence:NM_007614.3Link to Protein Sequence:NP_031640.1Re-query CCDS DB by Nucleotide ID:NM_007614Re-query CCDS DB by Protein ID:NP_031640Link to BLink:NP_031640.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159374.1 781 Q02248 781 100% 0 0
NP_031640.1 781 Q02248 781 100% 0 0

Chromosomal Locations for CCDS 23630.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

Chromosome Start Stop Links
9 120950221 120950233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120950522 120950749 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120950894 120951147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120951267 120951505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120951586 120951787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120952859 120953003 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120955148 120955251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120955329 120955667 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120955814 120955972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120957107 120957226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120957517 120957667 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120957759 120957880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120958592 120958652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 120959309 120959517 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2346 nt):
ATGGCTACTCAAGCTGACCTGATGGAGTTGGACATGGCCATGGAGCCGGACAGAAAAGCTGCTGTCAGCC
AC
TGGCAGCAGCAGTCTTACTTGGATTCTGGAATCCATTCTGGTGCCACCACCACAGCTCCTTCCCTGAG
T
GGCAAGGGCAACCCTGAGGAAGAAGATGTTGACACCTCCCAAGTCCTTTATGAATGGGAGCAAGGCTTT
TCC
CAGTCCTTCACGCAAGAGCAAGTAGCTGATATTGACGGGCAGTATGCAATGACTAGGGCTCAGAGGG
TC
CGAGCTGCCATGTTCCCTGAGACGCTAGATGAGGGCATGCAGATCCCATCCACGCAGTTTGACGCTGC
T
CATCCCACTAATGTCCAGCGCTTGGCTGAACCATCACAGATGTTGAAACATGCAGTTGTCAATTTGATT
AAC
TATCAGGATGACGCGGAACTTGCCACACGTGCAATTCCTGAGCTGACAAAACTGCTAAACGATGAGG
AC
CAGGTGGTAGTTAATAAAGCTGCTGTTATGGTCCATCAGCTTTCCAAAAAGGAAGCTTCCAGACATGC
C
ATCATGCGCTCCCCTCAGATGGTGTCTGCCATTGTACGCACCATGCAGAATACAAATGATGTAGAGACA
GCT
CGTTGTACTGCTGGGACTCTGCACAACCTTTCTCACCACCGCGAGGGCTTGCTGGCCATCTTTAAGT
CT
GGTGGCATCCCAGCGCTGGTGAAAATGCTTGGGTCACCAGTGGATTCTGTACTGTTCTACGCCATCAC
G
ACACTGCATAATCTCCTGCTCCATCAGGAAGGAGCTAAAATGGCAGTGCGCCTAGCTGGTGGACTGCAG
AAA
ATGGTTGCTTTGCTCAACAAAACAAACGTGAAATTCTTGGCTATTACAACAGACTGCCTTCAGATCT
TA
GCTTATGGCAATCAAGAGAGCAAGCTCATCATTCTGGCCAGTGGTGGACCCCAAGCCTTAGTAAACAT
A
ATGAGGACCTACACTTATGAGAAGCTTCTGTGGACCACAAGCAGAGTGCTGAAGGTGCTGTCTGTCTGC
TCT
AGCAACAAGCCGGCCATTGTAGAAGCTGGTGGGATGCAGGCACTGGGGCTTCATCTGACAGACCCAA
GT
CAGCGACTTGTTCAAAACTGTCTTTGGACTCTCAGAAACCTTTCAGATGCAGCGACTAAGCAGGAAGG
G
ATGGAAGGCCTCCTTGGGACTCTAGTGCAGCTTCTGGGTTCCGATGATATAAATGTGGTCACCTGTGCA
GCT
GGAATTCTCTCTAACCTCACTTGCAATAATTACAAAAACAAGATGATGGTGTGCCAAGTGGGTGGCA
TA
GAGGCTCTTGTACGCACCGTCCTTCGTGCTGGTGACAGGGAAGACATCACTGAGCCTGCCATCTGTGC
T
CTTCGTCATCTGACCAGCCGGCATCAGGAAGCCGAGATGGCCCAGAATGCCGTTCGCCTTCATTATGGA
CTG
CCTGTTGTGGTTAAACTCCTGCACCCACCATCCCACTGGCCTCTGATAAAGGCAACTGTTGGATTGA
TT
CGAAACCTTGCCCTTTGCCCAGCAAATCATGCGCCTTTGCGGGAACAGGGTGCTATTCCACGACTAGT
T
CAGCTGCTTGTACGAGCACATCAGGACACCCAACGGCGCACCTCCATGGGTGGAACGCAGCAGCAGTTT
GTG
GAGGGCGTGCGCATGGAGGAGATAGTAGAAGGGTGTACTGGAGCTCTCCACATCCTTGCTCGGGACG
TT
CACAACCGGATTGTAATCCGAGGACTCAATACCATTCCATTGTTTGTGCAGTTGCTTTATTCTCCCAT
T
GAAAATATCCAAAGAGTAGCTGCAGGGGTCCTCTGTGAACTTGCTCAGGACAAGGAGGCTGCAGAGGCC
ATT
GAAGCTGAGGGAGCCACAGCTCCCCTGACAGAGTTACTCCACTCCAGGAATGAAGGCGTGGCAACAT
AC
GCAGCTGCTGTCCTATTCCGAATGTCTGAGGACAAGCCACAGGATTACAAGAAGCGGCTTTCAGTCGA
G
CTGACCAGTTCCCTCTTCAGGACAGAGCCAATGGCTTGGAATGAGACTGCAGATCTTGGACTGGACATT
GGT
GCCCAGGGAGAAGCCCTTGGATATCGCCAGGATGATCCCAGCTACCGTTCTTTTCACTCTGGTGGAT
AC
GGCCAGGATGCCTTGGGGATGGACCCTATGATGGAGCATGAGATGGGTGGCCACCACCCTGGTGCTGA
C
TATCCAGTTGATGGGCTGCCTGATCTGGGACACGCCCAGGACCTCATGGATGGGCTGCCCCCAGGTGAT
AGC
AATCAGCTGGCCTGGTTTGATACTGACCTGTAA


Translation (781 aa):
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGF
S
QSFTQEQVA
DIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLI
N
YQDDAELATRAIPELTKLLNDEDQ
VVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVET
A
RCTAGTLHNLSHHREGLLAIFKSGGIPALVKML
GSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQ
K
MVALLNKTNVKFLAITTDCLQILAYGNQESK
LIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVC
S
SNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
A
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG
L
PVVVKLLHPPSHWPLIK
ATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQF
V
EGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEA
I
EAEGATAPLTELLHSRNEGV
ATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI
G
AQGEALGYRQD
DPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGD
S
NQLAWFDTDL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser