NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23451.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23451.1 Public Mus musculus 9 Trf 16 104 75 CCDS HistoryNCBI Gene:22041Re-query CCDS DB by CCDS ID:23451.1Re-query CCDS DB by GeneID:22041See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23451.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035158 ENSMUSP00000035158 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035158Link to Ensembl Protein Viewer:ENSMUSP00000035158Re-query CCDS DB by Nucleotide ID:ENSMUST00000035158Re-query CCDS DB by Protein ID:ENSMUSP00000035158
Original member Current member EBI,WTSI ENSMUST00000112645 ENSMUSP00000108264 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112645Link to Ensembl Protein Viewer:ENSMUSP00000108264Re-query CCDS DB by Nucleotide ID:ENSMUST00000112645Re-query CCDS DB by Protein ID:ENSMUSP00000108264
Original member Current member EBI,WTSI OTTMUST00000060811 OTTMUSP00000029708 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000060811Link to Vega Protein Viewer:OTTMUSP00000029708Re-query CCDS DB by Nucleotide ID:OTTMUST00000060811Re-query CCDS DB by Protein ID:OTTMUSP00000029708
Original member Current member EBI,WTSI OTTMUST00000060812 OTTMUSP00000029709 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000060812Link to Vega Protein Viewer:OTTMUSP00000029709Re-query CCDS DB by Nucleotide ID:OTTMUST00000060812Re-query CCDS DB by Protein ID:OTTMUSP00000029709
Original member Current member NCBI NM_133977.2 NP_598738.1 Accepted alive Link to Nucleotide Sequence:NM_133977.2Link to Protein Sequence:NP_598738.1Re-query CCDS DB by Nucleotide ID:NM_133977Re-query CCDS DB by Protein ID:NP_598738Link to BLink:NP_598738.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598738.1 697 Q921I1 697 100% 0 0

Chromosomal Locations for CCDS 23451.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 103209044 103209078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103210495 103210678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103211812 103211996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103215193 103215257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103215814 103215943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103217363 103217533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103219223 103219255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103219802 103219892 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103220893 103221044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103222051 103222228 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103222935 103223113 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103223584 103223639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103225043 103225175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103225961 103226137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103226838 103226946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103227896 103228068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 103230174 103230216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2094 nt):
ATGAGGCTCACCGTGGGTGCCCTGCTGGCCTGCGCTGCCCTGGGGCTGTGTCTGGCTGTCCCTGACAAAA
CG
GTCAAATGGTGCGCAGTGTCAGAGCACGAGAATACCAAGTGCATCAGCTTCCGTGACCACATGAAGAC
C
GTCCTTCCGCCTGATGGCCCCCGGCTTGCCTGTGTGAAGAAAACCTCCTATCCGGATTGCATCAAGGCC
ATT
TCTGCAAGTGAAGCCGATGCTATGACCTTGGATGGGGGTTGGGTGTACGATGCCGGCCTGACTCCGA
AC
AACCTGAAGCCCGTGGCGGCGGAGTTTTATGGATCAGTGGAACATCCACAGACCTACTACTACGCTGT
G
GCTGTGGTAAAGAAGGGAACAGACTTCCAGCTGAACCAGCTCGAAGGCAAGAAGTCCTGCCACACAGGC
CTG
GGAAGGTCTGCAGGCTGGGTCATCCCCATTGGCTTGCTCTTCTGTAAGCTGTCGGAGCCCCGCAGTC
CT
CTTGAGAAAGCTGTGTCCAGTTTCTTCTCGGGCAGTTGTGTCCCCTGTGCAGATCCAGTGGCCTTCCC
C
AAACTGTGTCAACTGTGCCCAGGCTGTGGCTGCTCCTCCACTCAACCATTCTTTGGCTACGTAGGCGCA
TTC
AAGTGTCTGAAAGATGGCGGTGGGGATGTGGCCTTTGTCAAGCACACAACCATATTTGAGGTCTTGC
CG
GAGAAGGCTGACAGGGACCAATATGAACTGCTCTGCCTTGACAATACCCGCAAGCCAGTGGATCAGTA
T
GAGGATTGCTACCTGGCTCGGATCCCTTCTCATGCTGTTGTGGCTCGAAAAAACAATGGCAAGGAAGAC
TTG
ATCTGGGAGATTCTCAAAGTGGCACAGGAACACTTTGGCAAAGGCAAATCAAAAGACTTCCAACTGT
TC
AGCTCTCCTCTTGGGAAAGACCTGCTGTTTAAAGATTCTGCCTTTGGGCTGTTAAGGGTCCCCCCAAG
G
ATGGACTACAGGCTGTACCTTGGCCATAACTATGTCACTGCCATTCGGAATCAGCAGGAAGGCGTGTGC
CCG
GAGGGCTCGATCGACAACTCGCCAGTGAAGTGGTGTGCACTGAGTCACCTGGAGAGAACCAAGTGTG
AC
GAGTGGAGCATCATCAGTGAGGGAAAGATAGAGTGTGAGTCAGCAGAGACCACTGAGGACTGCATTGA
A
AAGATTGTGAACGGAGAAGCGGACGCCATGACTTTGGATGGAGGACATGCCTACATTGCAGGCCAGTGT
GGT
CTAGTGCCTGTCATGGCAGAGTACTACGAGAGCTCTAATTGTGCCATCCCATCACAACAAGGTATCT
TT
CCTAAAGGGTATTATGCCGTGGCTGTGGTGAAGGCATCGGACACTAGCATCACCTGGAACAACCTGAA
A
GGCAAGAAGTCCTGCCACACTGGGGTAGACAGAACCGCTGGTTGGAACATCCCTATGGGCATGCTGTAC
AAC
AGGATCAACCACTGCAAATTCGATGAATTTTTCAGTCAAGGCTGCGCTCCCGGGTATGAGAAGAATT
CC
ACCCTCTGTGACCTGTGTATTGGCCCACTCAAATGTGCTCCGAACAACAAAGAGGAATATAATGGTTA
C
ACAGGGGCTTTCAGGTGTCTCGTTGAGAAAGGAGATGTAGCCTTTGTGAAACACCAGACTGTCCTGGAT
AAC
ACCGAAGGAAAGAACCCTGCCGAATGGGCTAAGAATCTGAAGCAGGAAGACTTCGAGTTGCTCTGCC
CT
GATGGCACCAGGAAGCCTGTGAAAGATTTTGCCAGCTGCCACCTGGCCCAAGCTCCAAACCATGTTGT
G
GTCTCACGAAAAGAGAAGGCAGCCCGGGTTAAGGCTGTACTGACTAGCCAGGAGACTTTATTTGGGGGA
AGT
GACTGCACCGGCAATTTCTGTTTGTTCAAGTCCACCACCAAGGACCTTCTGTTCAGGGATGACACCA
AA
TGTTTCGTTAAACTTCCAGAGGGTACCACACCTGAAAAATACTTAGGAGCGGAGTACATGCAATCTGT
C
GGTAACATGAGGAAGTGCTCAACCTCACGACTCCTGGAAGCCTGCACTTTCCACAAACATTAA


Translation (697 aa):
MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVKKTSYPDCIKA
I
S
ASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTG
L
GRSAGWVIPIGLLFCKLSEPRSPLEK
AVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGA
F
KCLKDGGGDVAFVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKED
L
IWEILKVAQ
EHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVTAIRNQQEGVC
P
EGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKIV
NGEADAMTLDGGHAYIAGQC
G
LVPVMAEYY
ESSNCAIPSQQGIFPKGYYAVAVVKASDTSITWNNLKGKKSCHTGVDRTAGWNIPMGMLY
N
RINHCKF
DEFFSQGCAPGYEKNSTLCDLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLD
N
TE
GKNPAEWAKNLKQEDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGG
S
DCTGNFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTS
RLLEACTFHKH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser