NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23404.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23404.1 Public Mus musculus 9 Zic4 16 104 75 CCDS HistoryNCBI Gene:22774Re-query CCDS DB by CCDS ID:23404.1Re-query CCDS DB by GeneID:22774

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23404.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000173933 ENSMUSP00000133958 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000173933Link to Ensembl Protein Viewer:ENSMUSP00000133958Re-query CCDS DB by Nucleotide ID:ENSMUST00000173933Re-query CCDS DB by Protein ID:ENSMUSP00000133958
Original member Current member EBI,WTSI ENSMUST00000172646 ENSMUSP00000134053 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000172646Link to Ensembl Protein Viewer:ENSMUSP00000134053Re-query CCDS DB by Nucleotide ID:ENSMUST00000172646Re-query CCDS DB by Protein ID:ENSMUSP00000134053
Original member Current member EBI,WTSI OTTMUST00000098025 OTTMUSP00000055013 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000098025Link to Vega Protein Viewer:OTTMUSP00000055013Re-query CCDS DB by Nucleotide ID:OTTMUST00000098025Re-query CCDS DB by Protein ID:OTTMUSP00000055013
Original member Current member EBI,WTSI OTTMUST00000098028 OTTMUSP00000055015 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000098028Link to Vega Protein Viewer:OTTMUSP00000055015Re-query CCDS DB by Nucleotide ID:OTTMUST00000098028Re-query CCDS DB by Protein ID:OTTMUSP00000055015
Original member Current member NCBI NM_009576.2 NP_033602.2 Accepted alive Link to Nucleotide Sequence:NM_009576.2Link to Protein Sequence:NP_033602.2Re-query CCDS DB by Nucleotide ID:NM_009576Re-query CCDS DB by Protein ID:NP_033602Link to BLink:NP_033602.2

Chromosomal Locations for CCDS 23404.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

Chromosome Start Stop Links
9 91372623 91372692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 91378785 91379402 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 91384014 91384329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 91386535 91386535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1005 nt):
ATGAAATACAAGACTTCCCTGGTGATGAGGAAGCGGTTACGGCTGTACAGAAACACTCTGAAAGAATCAA
GT
AGCAGCTGTGGACACCATGGGCCCCAGCTCGCCGCTTCTTCGAACCCCTCCGTGCTTCCGGGCCTTCA
C
GAGCAGCCTCCTCAGGCCTCCCACAGCCGTCCTTTGAACGGACTCCTGCGTCTGGGGATCCCTGGAGAC
ATG
TATGCGAGGTCGGAACCTTTTGCACCAGGGCCTATGGCCCGCAGCGACACTCTGGCAACAGCCACAG
CC
CTGCACGGTTATGGCGGCATGAACCTGACCATGAACCTCACCGCACCCCATGGCCCTGGAGCCTTTTT
C
CGCTATATGCGCCAGCCCATCAAACAGGAGCTCATCTGCAAGTGGCTAGGGGATGACAGCCCGATGTCC
CCG
CGTCCCTGCTCCAAAACTTTCAGCACCATGCACGAGCTGGTCACGCACGTCACTGTGGAGCACGTCG
GT
GGCCCAGAGCAGGCTAACCACATTTGCTTCTGGGAGGAGTGTCCGCGACAGGGCAAGCCCTTCAAAGC
C
AAATACAAACTTGTAAATCACATCCGCGTGCACACGGGCGAGAAGCCCTTCCCTTGTCCTTTCCCAGGG
TGT
GGGAAGGTCTTTGCTAGATCAGAAAATCTCAAAATACACAAACGAACACATACAGGCGAGAAACCTT
TC
AGATGTGAGTTCGAGGGCTGTGAGAGGCGTTTCGCCAACAGCAGCGACCGCAAGAAACATTCGCACGT
G
CACACGAGCGACAAGCCTTATATGTGCAAGGTGCGCGGGTGTGACAAGTGTTACACGCACCCCAGCTCT
CTG
CGAAAGCACATGAAAGTTCATGGTCGCTCACCGCCACCCAGCTCTGGCTACGACTCGGCTATAACGT
CT
GCTCTCGCGTCGCCCTCGTTAGAAAGCGGCCGTGAGCCCTCAGTGGCTTGCTCTGCGGCGGTGGTTGT
G
CGTGGCACAGACGTGAGCGAATGA


Translation (334 aa):
MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPGLHEQPPQASHSRPLNGLLRLGIPGD
M
YARSEPFAPGPMARSDTLATATALHGYGGMNLTMNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMS
P
RPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPG
C
GKVFARSENLKIHKRTHT
GEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSS
L
RKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser