NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22910.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22910.1 Public Mus musculus 9 Ldlr 16 104 75 CCDS HistoryNCBI Gene:16835Re-query CCDS DB by CCDS ID:22910.1Re-query CCDS DB by GeneID:16835See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22910.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034713 ENSMUSP00000034713 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034713Link to Ensembl Protein Viewer:ENSMUSP00000034713Re-query CCDS DB by Nucleotide ID:ENSMUST00000034713Re-query CCDS DB by Protein ID:ENSMUSP00000034713
Original member Current member NCBI NM_010700.3 NP_034830.2 Accepted alive Link to Nucleotide Sequence:NM_010700.3Link to Protein Sequence:NP_034830.2Re-query CCDS DB by Nucleotide ID:NM_010700Re-query CCDS DB by Protein ID:NP_034830Link to BLink:NP_034830.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034830.2 862 P35951 862 100% 0 0

Chromosomal Locations for CCDS 22910.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 21723778 21723844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21731747 21731869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21732312 21732434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21733491 21733874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21735237 21735359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21737220 21737342 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21737874 21737993 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21738855 21738980 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21739386 21739557 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21739649 21739873 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21742187 21742305 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21742657 21742796 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21743922 21744063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21744230 21744385 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21745732 21745905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21746362 21746439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21747149 21747306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21748141 21748176 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2589 nt):
ATGAGCACCGCGGATCTGATGCGTCGCTGGGTCATCGCCCTGCTCCTGGCTGCTGCCGGAGTTGCAGCAG
AA
GACTCATGCAGCAGGAACGAGTTCCAGTGTAGAGACGGAAAATGCATCGCTAGCAAGTGGGTGTGCGA
T
GGCAGCCCCGAGTGCCCGGATGGCTCCGATGAGTCCCCAGAGACATGCATGTCTGTCACCTGTCAGTCC
AAT
CAATTCAGCTGTGGAGGCCGTGTCAGCCGATGCATTCCTGACTCCTGGAGATGTGATGGACAGGTAG
AC
TGTGAAAATGACTCAGACGAACAAGGCTGTCCCCCCAAGACGTGCTCCCAGGATGACTTCCGATGCCA
G
GATGGCAAGTGCATCTCCCCGCAGTTTGTGTGTGATGGAGACCGAGATTGCCTAGATGGCTCTGATGAG
GCC
CACTGCCAGGCCACCACTTGTGGCCCCGCCCACTTCCGCTGCAACTCATCCATATGCATCCCCAGTC
TT
TGGGCCTGCGACGGGGATGTCGACTGTGTTGACGGCTCCGATGAGTGGCCACAGAACTGCCAGGGCCG
A
GACACGGCCTCCAAAGGCGTTAGCAGCCCCTGCTCCTCCCTGGAGTTCCACTGTGGTAGCAGTGAGTGT
ATC
CATCGCAGCTGGGTCTGTGACGGCGAGGCAGACTGCAAGGACAAGTCAGATGAGGAGCACTGCGCGG
TG
GCCACCTGCCGACCTGATGAATTCCAGTGTGCAGATGGCTCCTGCATTCACGGTAGCCGCCAGTGTGA
C
CGTGAACATGACTGCAAGGACATGAGCGACGAGCTCGGCTGCGTCAATGTGACACAGTGTGATGGCCCC
AAC
AAGTTCAAGTGTCACAGTGGGGAGTGCATCAGCTTGGACAAGGTGTGCGACTCCGCCCGCGACTGCC
AG
GACTGGTCGGATGAGCCCATCAAGGAGTGCAAGACCAACGAGTGTTTGGACAACAATGGTGGCTGTTC
C
CACATCTGCAAGGACCTCAAGATTGGCTCTGAGTGCCTGTGTCCCAGCGGCTTCCGGTTGGTGGACCTC
CAC
AGGTGTGAAGATATTGACGAGTGTCAGGAGCCAGACACCTGCAGCCAGCTCTGTGTGAACCTGGAAG
GC
AGCTACAAGTGTGAGTGCCAGGCCGGCTTCCACATGGACCCACACACCAGGGTCTGCAAGGCTGTGGG
C
TCCATAGGCTATCTGCTCTTCACCAACCGCCACGAGGTCCGGAAGATGACCCTGGACCGCAGCGAGTAC
ACC
AGTCTGCTCCCCAACCTGAAGAATGTGGTGGCTCTCGACACGGAGGTGACCAACAATAGAATCTACT
GG
TCCGACCTGTCCCAAAAAAAGATCTACAGCGCCCTGATGGACCAGGCCCCTAACTTGTCCTACGACAC
C
ATCATCAGTGAGGACCTGCATGCCCCTGACGGGCTGGCGGTAGACTGGATCCACCGCAACATCTACTGG
ACA
GATTCAGTCCCAGGCAGCGTATCTGTGGCTGACACCAAGGGCGTAAAGAGGAGGACACTGTTCCAAG
AG
GCAGGGTCCAGACCCAGAGCCATCGTAGTGGACCCTGTGCATGGCTTCATGTACTGGACAGATTGGGG
A
ACACCCGCCAAGATCAAGAAAGGGGGTTTGAATGGTGTGGACATCCACTCACTGGTGACCGAAAACATC
CAG
TGGCCAAATGGCATCACACTAGATCTTTCCAGTGGCCGTCTCTATTGGGTTGATTCCAAACTCCACT
CT
ATCTCCAGCATCGATGTCAATGGGGGCAATCGGAAAACCATTTTGGAGGATGAGAACCGGCTGGCCCA
C
CCCTTCTCCTTGGCCATCTATGAGGACAAAGTGTATTGGACAGATGTCATAAACGAAGCCATTTTCAGT
GCC
AATCGACTCACGGGTTCAGATGTGAATTTGGTGGCTGAAAACCTCTTGTCCCCGGAGGACATTGTCC
TG
TTCCACAAGGTCACACAGCCTAGAGGGGTGAACTGGTGTGAGACAACAGCCCTCCTCCCCAATGGTGG
T
TGCCAGTACCTGTGCCTGCCCGCCCCACAGATCGGTCCCCACTCGCCCAAATTCACCTGCGCCTGCCCT
GAT
GGCATGCTGCTGGCCAAGGACATGCGGAGCTGCCTCACAGAAGTCGACACTGTACTGACCACCCAGG
GG
ACATCCGCCGTCCGGCCTGTGGTCACCGCATCAGCTACCAGGCCACCGAAGCACAGTGAGGATCTCTC
A
GCTCCCAGTACTCCTAGGCAGCCTGTGGACACCCCAGGGCTCAGCACAGTGGCGTCAGTGACAGTGTCC
CAC
CAAGTCCAGGGTGACATGGCTGGCAGAGGGAATGAGGAGCAGCCACATGGTATGAGGTTCCTGTCCA
TC
TTCTTCCCTATTGCACTGGTTGCCCTCCTTGTCCTTGGGGCCGTCCTGCTGTGGAGGAACTGGCGGCT
G
AAGAACATCAACAGCATAAACTTTGACAACCCAGTCTACCAGAAGACCACAGAGGACGAGCTCCACATT
TGC
CGAAGCCAGGATGGCTATACCTACCCCTCAAGACAGATGGTCAGCCTGGAGGACGATGTGGCATGA


Translation (862 aa):
MSTADLMRRWVIALLLAAAGVAAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQS
N
QFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGC
PPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDE
A
HCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSEC
I
HRSWVCDGEADCKDKSDEEHC
AVATCRPDEFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGP
N
KFKCHSGECISLDKVCDSARDCQDWSDEPIKEC
KTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDL
H
RCE
DIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEY
T
SLLPNLKNVVALDTEVTNNRIYWSDLSQKKIY
SALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYW
T
DSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVH
GFMYWTDWGTPAKIKKGGLNGVDIHSLVTENI
Q
WPNGITL
DLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFS
A
NRLTGSDVNLVAENLLSPEDIVLFHKVTQPR
GVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACP
D
GMLLAKDMRSCLT
EVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVS
H
Q
VQGDMAGRGNEEQPHGMRFLSIFFPIALVALLVLGAVLLWRNWRLKNINSINFDNPVYQKTTEDELHI
C
RSQDGYTYPS
RQMVSLEDDVA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser