NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22204.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22204.1 Public Mus musculus 8 Pomk 16 104 75 CCDS HistoryNCBI Gene:74653Re-query CCDS DB by CCDS ID:22204.1Re-query CCDS DB by GeneID:74653See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22204.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000061850 ENSMUSP00000053802 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000061850Link to Ensembl Protein Viewer:ENSMUSP00000053802Re-query CCDS DB by Nucleotide ID:ENSMUST00000061850Re-query CCDS DB by Protein ID:ENSMUSP00000053802
Original member Current member NCBI NM_029037.4 NP_083313.1 Accepted alive Link to Nucleotide Sequence:NM_029037.4Link to Protein Sequence:NP_083313.1Re-query CCDS DB by Nucleotide ID:NM_029037Re-query CCDS DB by Protein ID:NP_083313Link to BLink:NP_083313.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083313.1 349 Q3TUA9 349 100% 0 0

Chromosomal Locations for CCDS 22204.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 25982874 25983644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 25986246 25986524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1050 nt):
ATGGGACAGCAACATGGAACCAGGAATGGTCTCACGCATAGAGAGCTCCCCCGGGGCGTGGGGCTGCTGC
TC
GCCATGGCCCTTATGAACGTGGCGCTCTACCTCTGCCTTGATCAGCTTTTCATCTCCCCTGGACGATC
C
ACCGCGGACTCTAGGCGCTGTCCTCCGGGCTACTTCAGAATGGGGCGGATGAGAAACTGCTCACGCTGG
CTG
TCCTGTGAAGAGCTGAGGACAGAAGTCAGGCAGCTGAAGCGCGTTGGGGAGGGAGCCGTGAAGAGAG
TC
TTTCTGTCTGAATGGAAGGAACACAAAGTCGCTCTCTCCCGGCTCACCAGGCTGGAGATGAAGGAGGA
C
TTCCTGCATGGGCTGCAGATGCTGAAGTCTCTACAGAGTGAGCACGTGGTCACGCTGGTGGGCTACTGT
GAG
GAAGATGGCACTATTCTCACCGAATATCACCCCTTAGGTTCCTTGAGCAACCTGGAAGAAACACTAA
AC
CTTTCAAAGTACCAAGACGTGAACACTTGGCAGCACAGGCTGCAGCTGGCCATGGAGTACGTCAGCAT
C
ATTAACTATCTGCATCACAGCCCCCTGGGCACGAGGGTCATGTGTGACTCTAACGACCTGCCCAAAACA
TTG
TCCCAGTACCTGCTAACAAGTAACTTCAGCATTGTGGCAAACGACCTGGACGCTCTGCCCCTGGTAG
AC
CATGACTCTGGGGTACTTATAAAGTGTGGCCACAGAGAGCTCCATGGGGATTTTGTGGCTCCAGAGCA
G
CTGTGGCCCTACGGAGAAGACACGCCCTTCCAAGACGATCTCATGCCTTCCTACAATGAGAAGGTTGAC
ATC
TGGAAGATTCCAGATGTCTCCAGTTTCCTCTTGGGGCACGTGGAAGGGAGTGATATGGTTAGATTCC
AT
TTGTTTGATATCCATAAGGCGTGCAAGAGCCAGATCCCGGCAGAAAGACCCACTGCTCAGAACGTGCT
A
GACGCTTACCAGAGGGTTTTCCATTCACTCCGAGACACTGTGATGTCGCAGACGAAAGAAATGCTGTAA


Translation (349 aa):
MGQQHGTRNGLTHRELPRGVGLLLAMALMNVALYLCLDQLFISPGRSTADSRRCPPGYFRMGRMRNCSRW
L
SCEELRTEVRQLKRVGEGAVKR
VFLSEWKEHKVALSRLTRLEMKEDFLHGLQMLKSLQSEHVVTLVGYC
E
EDGTILTEYHPLGSLSNLEETLNLSKYQDVNTWQHRLQLAMEYVSIINYLHHSPLGTRVMCDSNDLPKT
L
SQYLLTSNFSIVANDLDALPLVDHDSGVLIKCGHRELHGDFVAPEQLWPYGEDTPFQDDLMPSYNEKVD
I
WKIPDVSSFLLGHVEGSDMVRFHLFDIHKACKSQIPAERPTAQNVLDAYQRVFHSLRDTVMSQTKEML




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser