NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21382.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21382.1 Public Mus musculus 7 Polg 16 104 75 CCDS HistoryNCBI Gene:18975Re-query CCDS DB by CCDS ID:21382.1Re-query CCDS DB by GeneID:18975

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21382.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000073889 ENSMUSP00000073551 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073889Link to Ensembl Protein Viewer:ENSMUSP00000073551Re-query CCDS DB by Nucleotide ID:ENSMUST00000073889Re-query CCDS DB by Protein ID:ENSMUSP00000073551
Original member Current member EBI,WTSI OTTMUST00000072160 OTTMUSP00000037076 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000072160Link to Vega Protein Viewer:OTTMUSP00000037076Re-query CCDS DB by Nucleotide ID:OTTMUST00000072160Re-query CCDS DB by Protein ID:OTTMUSP00000037076
Original member Current member NCBI NM_017462.2 NP_059490.2 Accepted alive Link to Nucleotide Sequence:NM_017462.2Link to Protein Sequence:NP_059490.2Re-query CCDS DB by Nucleotide ID:NM_017462Re-query CCDS DB by Protein ID:NP_059490Link to BLink:NP_059490.2

Chromosomal Locations for CCDS 21382.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 79449961 79450037 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79450485 79450645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79451542 79451750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79451860 79452028 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79452107 79452229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79453705 79453951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79454039 79454174 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79454594 79454711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79454811 79454864 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79455435 79455595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79456041 79456148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79456435 79456512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79456708 79456828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79458174 79458410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79459174 79459300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79459437 79459585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79459689 79459871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79460058 79460137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79460263 79460409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79460516 79460680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79461698 79461893 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 79464604 79465211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3654 nt):
ATGAGCCGCCTGCTCTGGAAGAAGGTGGCTGGCGCCAAGGTCGCCTCAGGGCCAGTACCAGCAACCGCGC
GC
TGGGTCTCCAGCTCCGTCCTCGACCCCGTCCCCAGCGACGGGCGGCCGCCGTCGCAAATGCCCTCCTC
C
GAGAATGGGCAGCTGCGGCTCAACCCTCTGCTCATCCAGATGTTGTCGAGAGGCCTGCACGAGCAGATC
TTC
GGGTGCGGCGGGGAAATGCCCGACGAGGCCGCGGTGCAGCGCAGCGTAGAGCACCTGCAGAAGCACG
GG
CTCTGGGGGCAGCCGGCCACGCCCTTGCCAGACGTGGAGCTGCGCCTGCCCCGGCTCTTCGGGGGCAA
C
CTGGACCAGCACTTCCGCCTCCTGGCCCAGAAGCAGAGCCTGCCTTACTTGGAGGCGGCCGCCTCGTTA
TTG
GAGGCCCAATTGCCCCCCGAGCCCAAGAGCTGGGCCTGGGCGGAGGGCTGGACCCGGTACGGCCCCG
AG
GGGGAGGCCGAACCCGTGGCCATCCCCGAGGAGCGGGCCCTGGTGTTCGACGTGGAGGTCTGCTTGGC
A
GAGGGAACCTGCCCCACTTTGGCGGTGGCCATATCCCCCTCGGCCTGGTATTCCTGGTGCAGCCGGCGG
CTG
GTGGAAGAGCGTTACTCTTGGACCAGCCAGCTATCGCCGGCTGACCTAATCCCTTTGGGGGGCTCCA
CT
AGTGCCAGCAGCTCCACCAAGCAGGATGGGCAGGAACAGTTAGTGGTGGGGCACAATGTTTCCTTTGA
C
CGAGCCCATATCAGGGAACAGTATCTGATTCAGGACTCCCGGATGCGTTTTCTCGATACTATGAGCATG
CAC
ATGGCCATCTCGGGGCTGAGCAGCTTCCAGCGCAGCCTGTGGATGGGAGCCAAGCAGGGAAAGCACA
AG
ACCCAGCAGTCCACAAAGCGAGGGCAGAAGTCCCCGAGGAAAGCCAATGGTCCAGCGATCTCATCTTG
G
GACTGGATGGATATCAGCAGTGCCAATAATCTTGCAGATGTGCACAACCTTTATGTGGGGGGACCTCCC
TTA
GAGAAGGAGCCTCGGGAGCTGTTCGTCAAAGGCAGCATGAGGGATATCCGAGAGAACTTCCAGGATC
TG
ATGCAGTACTGCGCCCGTGATGTGTGGGCCACCTTTGAGGTTTTCCAGCAGCAGCTGCCACTCTTCTT
G
GAGAGGTGTCCCCACCCAGTGACTCTGGCTGGCATGCTGGAGATGGGTGTGTCCTACCTGCCTGTCAAC
CAG
AACTGGGAGCGTTACCTGACAGAGGCACAGAACACATATGAGGAGCTCCAGCGGGAGATGAAGAAGT
CG
CTGATGGATCTGGCTAATGATGCCTGTCAGTTGCTCTCAGGAGAGAGGTACAAAGAAGACCCTTGGCT
C
TGGGACCTAGAATGGGATTTGCAGGAGTTTAAGCAGAAAAAGGCAAAGAAGGTGAAGAAGCCAGCCTCA
GCC
AGCAAGTTGCCCATCGAGGGAGCTGGGCCCTTTGGGGATCCCATGGATCAGGAAGATCCTGGCCCGC
CC
AGCGAGGAGGAGGAGCTTCAGCGAAGTGTAACAGCCCACAACCGGTTACAGCAGCTGAGGAGCACCAC
G
GACCTCCTGCCTAAGCGACCCCAGCACCTTCCAGGACACCCTGGGTGGTACCGGAAGCTCTGCCCTCGA
CTA
GATGACCCTGCCTGGGCTCCCGGCCCCAGCCTCCTCAGCCTGCAAATGCGGGTCACTCCTAAGCTCA
TG
GCACTGACCTGGGATGGTTTTCCTCTACACTACTCAGACTCTCATGGTTGGGGCTACCTAGTGCCTGG
G
CGTCGGGATAATCTGACCGAGCCGCCAGTGAGCCCCACTGTAGAATCCGCTGCAGTAACCTGCCCCTAC
AG
A
GCCATCGAGTCCTTATACAGGAAGCACTGCCTTGAACAGGGGAAGCAGCAATTGGAGCCCCAGGAGG
TA
GACCTGGCTGAGGAGTTCTTACTCACTGACAGTAGTGCCATGTGGCAAACGGTAGAAGAACTGGGCTG
C
TTAGACGTAGAGGCTGAGGCCAAGATGGAGAATTCAGGGCTGAGCCAACCTCTAGTTCTGCCTGCTGCT
TGT
GCCCCCAAATCCAGCCAGCCCACGTATCACCATGGCAACGGACCTTATAATGATGTGAATATCCCTG
GT
TGCTGGTTTTTCAAGCTGCCTCACAAGGACGGTAACAACTACAATGTGGGCAGTCCCTTTGCCAAAGA
T
TTCCTGCCCAAGATGGAGGATGGCACCCTGCAGGCTGGCCCAGGAGGTGCCAGTGGGCCTCGTGCCCTG
GAA
ATAAATAAAATGATTTCTTTTTGGAGGAATGCTCATAAACGTATCAGTTCCCAGATGGTGGTATGGC
TC
CCCAGGTCAGCTCTGCCCCGGGTTGTGACCAGGCACCCCAGCTTCGATGAGGAAGGCCACTATGGGGC
C
ATCCTACCCCAGGTGGTGACTGCTGGCACCATCACCCGTCGAGCTGTGGAGCCCACGTGGCTCACTGCC
AGT
AATGCTCGGCCTGACCGGGTAGGCAGTGAGTTGAAAGCCATGGTGCAGGCTCCACCTGGCTATGTCC
TT
GTGGGTGCTGATGTGGACTCACAGGAACTGTGGATCGCAGCTGTACTTGGAGATGCTCACTTTGCTGG
G
ATGCATGGCTGCACGGCCTTTGGCTGGATGACTCTGCAGGGCAGGAAGAGCAGAGGCACTGATCTGCAC
AGC
AAGACAGCTGCCACTGTGGGCATCAGCCGAGAGCATGCCAAAATCTTCAACTATGGCCGCATCTATG
GG
GCTGGGCAGTCCTTTGCTGAGCGCCTACTGATGCAGTTCAACCACAGGCTCACAAGGCAGGAGGCAGC
T
GAGAAGGCCCAGCAGATGTATGCAGTCACAAAAGGCCTGCGCCGGTATCGGCTGTCTGCGGATGGTGAG
TGG
CTGGTGAAACAGTTGAATCTTCCTGTGGACAGGACAGAGGACGGCTGGGTCTCCCTACAAGATCTTC
GA
ATGATCCGAAGAGAAGCTTCAAGGAAGTCACGATGGAAGAAGTGGGAGGTAGCCTCTGAACGAGCATG
G
ACAGGGGGCACAGAGTCAGAAATGTTTAATAAGCTGGAGAGTATTGCCATGTCTGATACACCACGTACC
CCA
GTACTGGGCTGCTGCATCAGCAGAGCCTTGGAGCCCTCAGTTGTCCAGGGAGAGTTTATAACCAGTC
GT
GTGAACTGGGTGGTACAGAGCTCTGCTGTAGACTACTTACATCTCATGCTTGTGGCCATGAAGTGGCT
G
TTTGAGGAATTTGCCATTGATGGGCGCTTCTGCATCAGCATCCACGACGAGGTTCGCTACCTGGTGCGT
GAG
GAGGACCGCTACCGTGCCGCCCTGGCACTGCAGATCACCAATCTCCTGACCAGGTGCATGTTTGCCT
AT
AAGCTGGGTCTGAATGATCTGCCCCAGTCAGTCGCCTTTTTCAGTGCAGTAGACATTGACCAGTGCCT
C
AGGAAGGAAGTGACCATGGACTGTAAAACTCCTTCTAACCCAACTGGGATGGAAAGGAGATATGGGATC
CCC
CAGGGTGAAGCACTGGATATTTACCAGATAATTGAACTCACCAAAGGCTCCTTGGAAAAACGAAGCC
AG
CCTGGACCCTAG


Translation (1217 aa):
MSRLLWKKVAGAKVASGPVPATARWVSSSVLDPVPSDGRPPSQMPSSENGQLRLNPLLIQMLSRGLHEQI
F
GCGGEMPDEAAVQRSVEHLQKHGLWGQPATPLPDVELRLPRLFGGNLDQHFRLLAQKQSLPYLEAAASL
L
EAQLPPEPKSWAWAEGWTRYGPEGEAEPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSA
WYSWCSRR
L
VEERYSWTSQLSPADLIPLGGSTSASSSTKQDGQEQLVVGHNVSFDRAHIREQYLIQ
DSRMRFLDTMSM
H
MAISGLSSFQRSLWMGAKQGKHKTQQSTKRGQKSPRKANGPA
ISSWDWMDISSANNLADVHNLYVGGPP
L
EKEPRELFVKGSMRDIRENFQ
DLMQYCARDVWATFEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVN
Q
NWERYLTEAQNTYEELQREMKKSLMDLANDACQLLSGE
RYKEDPWLWDLEWDLQEFKQKKAKKVKKPAS
A
SKLPIEGAGPFGDPMDQE
DPGPPSEEEELQRSVTAHNRLQQLRSTTDLLPKRPQHLPGHPGWYRKLCPR
L
DDPAWAPGPSLLSLQMRVTPKLMALTWDGFPLHYSDSHGWGYLVPGRRDNLTEPPVSPTVESAAVTCPY

R
AIESLYRKHCLEQGKQQLEPQEVDLAEEFLLTDSSAMWQTVEELGCLDVEAEAKMENSGLSQPLVLPAA
C
APKSSQPTYHHGNGPYNDVNIPGCWFFKLPHK
DGNNYNVGSPFAKDFLPKMEDGTLQAGPGGASGPRAL
E
INKMISFWRNAHKRI
SSQMVVWLPRSALPRVVTRHPSFDEEGHYGAILPQVVTAGTITRRAVEPTWLTA
S
NAR
PDRVGSELKAMVQAPPGYVLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLH
S
KTAATVGISREHAKIFNYGRIYGAGQSFAERLLMQFNHRLTRQEAAEKAQQMYAVTKGLR
RYRLSADGE
W
LVKQLNLPVDRTEDGWVSLQDLRMIRREASR
KSRWKKWEVASERAWTGGTESEMFNKLESIAMSDTPRT
P
VLGCCISRALEPSVVQGE
FITSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVR
E
EDRYRAALALQITNLLT
RCMFAYKLGLNDLPQSVAFFSAVDIDQCLRKEVTMDCKTPSNPTGMERRYGI
P
Q
GEALDIYQIIELTKGSLEKRSQPGP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser