NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20641.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20641.1 Public Mus musculus 6 Gpr19 16 104 75 CCDS HistoryNCBI Gene:14760Re-query CCDS DB by CCDS ID:20641.1Re-query CCDS DB by GeneID:14760See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20641.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111932 ENSMUSP00000107563 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111932Link to Ensembl Protein Viewer:ENSMUSP00000107563Re-query CCDS DB by Nucleotide ID:ENSMUST00000111932Re-query CCDS DB by Protein ID:ENSMUSP00000107563
Original member Current member EBI,WTSI ENSMUST00000116515 ENSMUSP00000112214 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000116515Link to Ensembl Protein Viewer:ENSMUSP00000112214Re-query CCDS DB by Nucleotide ID:ENSMUST00000116515Re-query CCDS DB by Protein ID:ENSMUSP00000112214
Original member Current member EBI,WTSI ENSMUST00000165392 ENSMUSP00000127876 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165392Link to Ensembl Protein Viewer:ENSMUSP00000127876Re-query CCDS DB by Nucleotide ID:ENSMUST00000165392Re-query CCDS DB by Protein ID:ENSMUSP00000127876
Original member Current member EBI,WTSI OTTMUST00000059659 OTTMUSP00000029038 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059659Link to Vega Protein Viewer:OTTMUSP00000029038Re-query CCDS DB by Nucleotide ID:OTTMUST00000059659Re-query CCDS DB by Protein ID:OTTMUSP00000029038
Original member Current member NCBI NM_001167695.2 NP_001161167.1 Accepted alive Link to Nucleotide Sequence:NM_001167695.2Link to Protein Sequence:NP_001161167.1Re-query CCDS DB by Nucleotide ID:NM_001167695Re-query CCDS DB by Protein ID:NP_001161167Link to BLink:NP_001161167.1
Original member Current member NCBI NM_001167696.2 NP_001161168.1 Accepted alive Link to Nucleotide Sequence:NM_001167696.2Link to Protein Sequence:NP_001161168.1Re-query CCDS DB by Nucleotide ID:NM_001167696Re-query CCDS DB by Protein ID:NP_001161168Link to BLink:NP_001161168.1
Original member Current member NCBI NM_001167700.2 NP_001161172.1 Accepted alive Link to Nucleotide Sequence:NM_001167700.2Link to Protein Sequence:NP_001161172.1Re-query CCDS DB by Nucleotide ID:NM_001167700Re-query CCDS DB by Protein ID:NP_001161172Link to BLink:NP_001161172.1
Original member Current member NCBI NM_008157.3 NP_032183.2 Accepted alive Link to Nucleotide Sequence:NM_008157.3Link to Protein Sequence:NP_032183.2Re-query CCDS DB by Nucleotide ID:NM_008157Re-query CCDS DB by Protein ID:NP_032183Link to BLink:NP_032183.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001161167.1 409 Q61121-2 409 100% 0 0
NP_001161168.1 409 Q61121-2 409 100% 0 0
NP_001161172.1 409 Q61121-2 409 100% 0 0
NP_032183.2 409 Q61121-2 409 100% 0 0

Chromosomal Locations for CCDS 20641.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 134869213 134870442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1230 nt):
ATGGATAACGACCAGCCGCCTGTGGTGACTGCCACCCTGCTGGTGCCCCTTCAGAACAGCAGCTGCGCGG
AA
GCAGCTGAGGCCCTGCTGCCCCATGGCCTGATGGGATTGCATGAGGAGCACAGCTGGATGAGCAACAG
G
ACAGAGCTTCAGTACGAGCTGAACCCTGGAGAGGTGGCCACCGCCAGCATCTTCTTTGGCGCTTTGTGG
TTG
TTCTCCATCTTTGGCAATTCCCTGGTATGTCTGGTCATCCACCGGAGCCGGAGGACTCAGTCCACCA
CC
AACTACTTCGTGGTGTCCATGGCGTGTGCTGACCTTCTCATCAGCGTGGCCAGCACGCCGTTTGTCGT
G
CTGCAGTTCACCACCGGGAGGTGGACCCTGGGTAGCGCCATGTGCAAGGTGGTCCGCTACTTCCAGTAC
CTC
ACCCCCGGCGTGCAGATCTACGTGCTGCTCTCCATCTGCATCGACCGCTTCTATACCATCGTCTACC
CG
CTGAGCTTCAAGGTGTCCCGAGAGAAGGCCAAGAAAATGATTGCAGCCTCCTGGATCTTGGACGCGGC
C
TTCGTGACGCCTGTCTTCTTTTTCTACGGCTCTAACTGGGATAGTCACTGTAACTACTTCCTCCCTCCC
TCC
TGGGAGGGAACTGCCTATACCGTCATCCACTTCTTGGTGGGCTTCGTGATTCCCTCCATCCTCATAA
TC
CTGTTTTACCAGAAGGTCATAAAGTATATCTGGAGAATAGGCACGGACGGGCGGACGCTGAGAAGGAC
G
ATGAACATTGTCCCCAGGACAAAGGTGAAAACGGTCAAGATGTTCCTGCTCTTGAACCTAGTGTTCCTG
TTC
TCCTGGCTACCTTTCCATGTGGCTCAGCTCTGGCATCCCCATGAGCAAGACTACAAGAAGAGCTCCC
TT
GTCTTCACGGCAGTCACGTGGGTATCTTTCAGCTCTTCAGCCTCGAAACCCACTCTGTACTCTATTTA
T
AATGCCAATTTTCGGAGAGGGATGAAAGAGACATTCTGCATGTCCTCGATGAAATGCTACCGCAGCAAT
GCC
TACACCATCACGACCAGCTCACGGATGGCCAAAAGAAACTATGTGGGCATTTCGGAAATCCCTCCCG
TG
AGCAGGACCATAACCAAAGACTCCATCTATGACTCATTTGACCGGGAGGCCAGGGAGAAGAAGCTCGC
C
TGGCCCATCAACTCAAACCCTCCAAACACTTTTGTCTGA


Translation (409 aa):
MDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHEEHSWMSNRTELQYELNPGEVATASIFFGALW
L
FSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQY
L
TPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPP
S
WEGTAYTVIHFLVGFVIPSILIILFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFL
F
SWLPFHVAQLWHPHEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSN
A
YTITTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWPINSNPPNTFV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser