NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20368.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20368.1 Public Mus musculus 6 16 104 75 CCDS HistoryNCBI Gene:74122Re-query CCDS DB by CCDS ID:20368.1Re-query CCDS DB by GeneID:74122See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20368.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032183 ENSMUSP00000032183 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032183Link to Ensembl Protein Viewer:ENSMUSP00000032183Re-query CCDS DB by Nucleotide ID:ENSMUST00000032183Re-query CCDS DB by Protein ID:ENSMUSP00000032183
Original member Current member EBI,WTSI OTTMUST00000058195 OTTMUSP00000028164 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058195Link to Vega Protein Viewer:OTTMUSP00000028164Re-query CCDS DB by Nucleotide ID:OTTMUST00000058195Re-query CCDS DB by Protein ID:OTTMUSP00000028164
Original member Current member NCBI NM_028766.2 NP_083042.1 Accepted alive Link to Nucleotide Sequence:NM_028766.2Link to Protein Sequence:NP_083042.1Re-query CCDS DB by Nucleotide ID:NM_028766Re-query CCDS DB by Protein ID:NP_083042Link to BLink:NP_083042.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083042.1 400 Q9DBS1 400 100% 0 0

Chromosomal Locations for CCDS 20368.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 91473887 91473898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91477245 91477394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91478206 91478340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91478706 91478800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91479573 91479622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91479881 91479950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91480650 91480720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91481932 91482053 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91482254 91482328 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91482661 91482762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91485317 91485434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 91486745 91486947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1203 nt):
ATGGCAGCGAACTATTCCAGTACCAGCAGCAGGAAAGAACATGTCAAAGTGACTTCTGAGCCCCAGCCAG
GC
TTCCTGGAGCGGCTGAGTGAGACTTCGGGCGGGATGTTCGTGGGGCTAATGACCTTCTTACTCTCCTT
C
TACTTAATTTTCACCAACGAGGGCCGAGCACTGAAGACAGCCACATCGCTTGCAGAGGGGCTGTCACTC
GTG
GTGTCCCCTGACAGCATCCATAGTGTAGCTCCGGAGAATGAAGGAAGACTGGTACACATAATCGGGG
CC
CTGCGGACTTCCAAGCTCTTGTCTGACCCAAATTATGGGGTCCATCTACCAGCTGTGAAACTGCGACG
G
CATGTGGAGATGTACCAGTGGGTGGAGACAGAAGAGTCCAGTGAGTACACGGAGGACGGACAGGTGAAG
AAG
GAGACAAAGTACTCCTACAACACAGAGTGGAGGTCAGAAATTGTCAACAGCAGAAACTTTGACCGAG
AG
ATTGGCCACAAAAACCCCAGTGCCATGGCAGTGGAGTCTTTCACAGCGACCGCCCCCTTTGTCCAGAT
T
GGCAGGTTTTTTCTCTCAGCAGGCCTCATTGACAAGATTGACAACTTCAAGGCCCTGAGCCTGGCCAAG
CTG
GAGGACCCCCATGTGGACATCATTCGCCGCGGAGACTTTTTCTACCACAGTGAAAACCCTAAATACC
CG
GAGGTTGGTGATGTGCGAGTCTCCTTTTCTTATGCGGGACTGAGCAGCGATGACCCTGACCTGGGCCC
G
GCTCACGTGGTTACTGTGATTGCCCGGCAACGAGGTGACCAACTAATCCCATATTCCACCAAGTCCGGG
GAC
ACCTTGTTGCTCCTGCACCATGGGGACTTCTCAGCTGAGGAGGTGTTTCGTAGAGAACAGAAGAGCA
AT
TCCATGAAGACATGGGGCCTGCGGGCGGCTGGATGGATGGCCATGTTTATGGGCCTCAACCTCATGAC
A
CGGATCCTCTACACCCTAGTGGACTGGTTTCCTGTCTTCCGAGACCTTGTCAACATTGGCCTGAAAGCC
TTT
GCCTTCTGTGTGGCCACTTCCCTGACCCTGTTGACTGTGGCTGCTGGCTGGCTCTTCTACCGACCGC
TG
TGGGCTGCTCTAATCGGCTGCCTGGCTCTGGTGCCCATTATCATTGCACGGACCCGGGTGCCAGCCAA
A
AAGCTGGAGTGA


Translation (400 aa):
MAANYSSTSSRKEHVKVTSEPQPGFLERLSETSGGMFVGLMTFLLSFYLIFTNEGRALKTATSLAEGLSL
V
VSPDSIHSVAPENEGRLVHIIGALRTSK
LLSDPNYGVHLPAVKLRRHVEMYQWVETEESSEYTEDGQVK
K
ETKYSY
NTEWRSEIVNSRNFDREIGHKNPSAMAVESFTATAPFVQIGRFFLSAGLIDKIDNFKALSLAK
L
EDPHVDIIRRGDFFYHSENPKYPE
VGDVRVSFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSG
D
TLLLLHHGDFSAE
EVFRREQKSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKA
F
AFCVATSLTLLTVAAGWLFYRPLWAALIGCLALVPIIIARTRVPAKKLE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser