NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20298.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20298.1 Public Mus musculus 6 Alms1 16 104 75 CCDS HistoryNCBI Gene:236266Re-query CCDS DB by CCDS ID:20298.1Re-query CCDS DB by GeneID:236266

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20298.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000072018 ENSMUSP00000071904 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072018Link to Ensembl Protein Viewer:ENSMUSP00000071904Re-query CCDS DB by Nucleotide ID:ENSMUST00000072018Re-query CCDS DB by Protein ID:ENSMUSP00000071904
Original member Current member EBI,WTSI OTTMUST00000059068 OTTMUSP00000028699 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059068Link to Vega Protein Viewer:OTTMUSP00000028699Re-query CCDS DB by Nucleotide ID:OTTMUST00000059068Re-query CCDS DB by Protein ID:OTTMUSP00000028699
Original member Current member NCBI NM_145223.2 NP_660258.2 Accepted alive Link to Nucleotide Sequence:NM_145223.2Link to Protein Sequence:NP_660258.2Re-query CCDS DB by Nucleotide ID:NM_145223Re-query CCDS DB by Protein ID:NP_660258Link to BLink:NP_660258.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660258.2 3251 Q8K4E0-1 3251 100% 0 0

Chromosomal Locations for CCDS 20298.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 85587646 85588026 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85599845 85599970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85601199 85601391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85607472 85607592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85608986 85609125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85610818 85610936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85615248 85615407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85619434 85623201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85624584 85624717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85627919 85629714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85641319 85641548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85643158 85643283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85651263 85651418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85656395 85656529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85667867 85667956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85677556 85678709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85694834 85694951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85696093 85696296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85696576 85696817 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85697313 85697466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85698158 85698221 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85701672 85701771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 85702594 85702638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (9756 nt):
ATGGAGCCTGAGGACCTGCCGTGGCCTGACGAGCTGGAGGAGGAGGAGGAAGAAGAGGAGGAGGAGGGCG
AG
GAAGAGGAGGGGAAGAAAGAGGTGGAGAACGCCTCGGCGGCGGCGACCGAGGAGGCCCTGACCTCTGA
G
GAGAGTGGGAGACTGGAAGAGTTCGAAGAGGCGGGGCCCGACTTGGATTTTAACTACGAGTCCCAGCGG
CAG
GAGAGCTCGGACGAAGAGGAGGACGAGCTGGCTAAAGCCTGGCTGCAGGCTCACCCCGACCGTCCTG
GC
AGTGCTTTCTCTCTGCCCCCTCCCACGCCTCCGCCTCCGCCTCCGCCTCTGTCCCCGCGGCTCCGGTA
C
ACCCCAGTGGAGCATCTGGGCAAGACTGAGGTTGTCCCACTGACTTGCCGTGTATGGCAGCAGTCATCA
TAT
CAAGATAATTCTAGAGCCCAGTTTTCCAACTCCAGTACAATGTTATTGGAAACAGGGGTCCGGTGGG
GC
TCTGAGGAGGATCAGAGAACAGAGTCTTGGCATTGTCTTCCTCAAGAAAGGGATTCTTCCCAAACCTT
G
GCTATGTCCCAGACTGAGATCGGCAGAGTAGAAGGAACAGAAGTACCAGACCTACCCTCTCAGGAGGGA
GGT
TTACCAGCTCAGTCACAGTGTCCAGGAAAGAAGCCAAAGCTGAATGTCTTGTGTTCTCCATTGCTAG
TG
ATACAGGATAACTTTGCTGCTCCTGATTTGCCTTTGCTGACATGTTTGATACAAGACCAAGAAGAGGT
T
GAGCCTGATTCCTTGTTTCAACAAAGTGAACTAGAATTTGCACCTTTGAGAGGAATTCCTGATAAGTCT
GAA
GATTCTGAATGGCTTGCTCGACCATCAGAAGTTAGTGAAGCTTTAATCCAAGCCACCTCAGAAACAT
CT
TCAGACTTAGCTAACAGTTGCTTTAGTATATCTCAGCATCCACTTACAGAGGGCCTGCAGGGGAAGGC
T
GAATCTGGTGTCCTTACTAGGTGTGGTGATGCTAAGTACTCCAGCCTTTATGAAAACCTTGGTGCACAG
AGT
GAAAGAATTGCTGTATTGCAGAGAGAGGTAGGTTGTTCTAATCTGGGCATTAGCCAGGCTTCTCCAT
CT
TCATTGCCTTCATTTGTTCCTCAAGAACCAACCAGTGAGCCGGAATACCATTCCTCCAATCTCAGAAT
G
TTGAGGGTATCTCCCGACACTCTGCTAACAACGCATACACATTCAGCAGGATCTGCTGACCAGAAGATT
GGA
GCAGCAGTAGTCTCTTCTGCTTACTCACAGGAAATAAAGCCTGGGAGTTTTCACCAAGAAGAGTTGC
CA
GATAGGCATCTTAATGAAGAGATTCGGAAAGTGTCACCTGCTCTTAGGACAGCTGGCCAGAAGCCAGA
G
ATGCTACCAGTACAATCTAGTTCTTACTCTAAAGGAATGAAATCTATTTTCTATCAACATCCTGTGTCA
CAT
GGCCATCAAGGCAAAGAGCCTCTAAGTGTTTCAGCTGTTTGTGGATCAGCTGGTAATAAAGCTTTCC
AC
CAGCTTTCCACATTATCAGACAGTCTACTAACTGAAGAAACATGGCCAGTTTCTGTTATTCCTGGCCT
A
GGTAACCAGAAGACTCCTTTACCATCAGAATTCTCTCTTTCATATTCTCATAGAGGAAAGAACCTGCCC
GAA
GATGTTGTGAAAGTTTCCACTGATTCTGGATCTGCTCACAAGAAGGCTGACATTCTAACAGCGTCCT
CT
AGAACCTACCAGCACAAAATGAAACCTGCTAATATTTACCACCAAGAGTTGCCAGACAGTCGTGTACC
T
ATAGGGACTAGAAAGGTTGCATTTGAATCTGGACCAGCTGGCCAGAAGTCTGGGGTTTCTCACCCATAT
GGT
GAGATGCCCAGTGTTTTCTATCAGCAGGGGTTGCCAGATAGGCATTCAGCAAAAAGCCCTACAAAAA
CC
TTTATCCCAGGACCAGCTGACCAGAAGACTGATCTATCACCAGTACCCCCTACTTCCTCTTCGCATGC
A
GAGAAGCCTGTTTCCCCCTACCAGTTAACCTTGCCAGGTAGTCATCTACCTGAAGATGTTTTCAAAGCT
TCT
TCTGTTTGTAAGTCATCTGATGAGCTATCTGGAATAACAGCTCTAACCTCTGCTTCCTACTCATATA
AA
GGGAGACCCAATAGTTCTTATCAGCAGAAGTTTCCAGACAGCCACCTAAATGAAGAGGCCCAGAAAAT
C
TTGGGTACAACTGGAACAGTAGACCAGAAGACAGTGACACCAACAATGTCTTCTTCCTTTTTACAAAAA
GAA
AAGCCTAGTATTTTCTACCAACAAACCCTGCCAGATGGTGGTCTGTCTGAAGAGGATCTGCAGGTTT
CA
GCTGTTCCTTGGCCAGCTGACCAGAACATTGCTATACCAACAGTAACTTCTGCTGCTTTCTCACAAAG
A
GAAAAGCCTCGGATTTTCTACCAACAGACTCTGTCAGTTGATCGTTTGCCTGGAGAGCCTCTGAATGTT
TTA
GGGACTTCTGGACCACCTGACCAGAACACTGGGGCACCAACAGTAACTCCTAGTTCCTACTTCCCTG
GA
GAAGAGTCCATTATTTTTTACCAAGCTGGCTTTCCAGGTAACACTCTGTCTGCAATGTCTTTTAAAGT
T
CCAAGGATTTCTGGATCAACTGAACAGACTAACGTAACAACAGGATCATCAAGTTCCTACTCAGTTGGA
GAG
AAGTCCATTATTTTCTACCATCAGGCCTTGCCAGATGGTCGTCTTCCTCAAGAAGCTTCTCCTGCAC
CA
GCTGACCTAAACACTGGGGAGCCACCAATGTATTTGGCTTCCTGTTCTGTTGGAGTAAAGCCCATTAT
T
TTCTACCAGCAGCCTATGTCAGATAGTCAGCGAACTAAAGGTCACAAAGAATCAGATGTTCCTGGACCA
ACT
GACCAGAAGACTGGCATAGCAACAGTGCATTCTACTTCCCAATCATATATAGGGAGGCGCACTGTTT
CT
TACCAGAAAGAGTTTCCAGATCTTAGTGAAAAGGCTTTGAAAGTTCTAGGTGATGTTGGATCCACTGA
A
CAGAAAACTCAAATACCAGTAGTGTCTTCTGCTCTCTTACACAAAGAGGGGCCTAGTGCTTACCAGGAG
GAT
TTGCCAGATCTTACTGAAGAACCTTTGCAAATTTTAGGTGTTTCTGAAGAAGTTTCTTCTAGCTCTT
AT
CAGAGGAAGTTACCAGATCATATTGAAGTATTTTTGAAATCAGTAGGCTCTGGCTCTGCTGATCGGAA
G
ACTGGGGCACAAATAGTCTCCTCAAGTAGAGAGAAGTCCAGTGGTTTTCATCAGCAGGAGTTGCCAAAT
ACT
GGTGGGGATGCAGTAGATGCTTTTCATCCCGAACCAGTTGTCCAGGAGGTCAGGAAGGTACAGACGC
CT
GGGGCACCAGCAGGACCTTCTAGTTCCCACTTCCATAAAGAAAAACTCAGTGATTATCAAAAGGCCTC
G
CCACATCGTGATCTAACTGAAAGTTCTTTGAAGGCTTCAACTGTTCCAGGACTATCTGATCAGAAAAAG
AAA
CCTGCAGTCTCATCTGGTTTCTGCTTACACAAAGAGAAACACGAGATTTCAGCTTCAGCTTTGCTGA
AT
TGCCAGACAGCCGAGTTGCTAACAGTTACTCAGAGGTCCTGTTTACATAGAGAGGATCCTGCAATTTC
A
ACTGTGATCAAACCAGATGACCAAAAGATTCCATTACCAACAACTTTTCATGGCTCCAGTGATCAAAAA
GTA
AAACCTGTTATTTTTGTTCAAAAACAGTTACGAGATAGAGATCAAAGTGAAGATATTCCGAAGATTT
CA
ACTGTCTCTGAGCCAACTGTTGTAAATACAGTTCTACCAGTACTTCTGCCTGGTTCTTACTCACACAG
A
GAGAAGTCAGATTCATTTTACCCACAGGAACTGCCAGATGGACATCTAACTGAAGTTGATCTGAAGGTT
TCA
AGCGGTCTTGGTCAAGCTGACCAGATTTCTGGGTTACCTACAGGTATTCCTGGTACTTATTCACACA
GT
GAAAAGCACCAGCTTATCTCAGAACATGTCCAAGAGCTGATGGATAACTTGAATTCTTCCGAGTCGTC
T
TGTCTCAGTGTGGATAGTATGCCTCTAAATTCACAAATCGATGATGGAGTTATCATATGTAAGCCAGAA
TCT
TTAGGTTTTGCCAATGCTGGCTGTGAGGAAATGCAGAATATAGATCGTGGTTCGAAAACTCTTAAGG
AA
ATTCAGACTCTCTTGATGGAAGCAGAAAATATGGCACTGAAACGATGCAATTTCTCTGTTCCCTTAGT
C
CCTTTCAGAGATGTTAACGATGTTTCATTTATACGATCAAAGAAGGTGGTTTGCTTCAAAGAATCCTCC
ACA
ACTGATGTTTGTACCCAGAGGGAATCATTTGTAGAAGAAGTTCCACACATTGAATATGTACAGAAGG
AC
ATTGGCACACAGACGAACCTTAAGTACCAGAGGGGTGTTGGAAATTGGGAATTTATCAGTTCAGCTAC
C
TTTAGAAGTCCTCTACAGGAAGCAGAAGGCACAGCTAGAATGGCATATGATGAAACTTTTAGGCAATAT
AAA
GCTGCCAGGTCTGTAATGAGGTCTGAACCTGAAGGCTGCAGTACAGGCATTGGGAATAAAATGATTA
TC
CCTATGATGACAATCATAAAGAGTGACTCGAGTAGTGATGTAAGTGATGGTTGCTGCTCATGGGACAA
C
AATTTACCAGAGTCTTTGGAATCTGTTTCTGATGTTTTTCTAAACTTCTTTCCATATACTTCACCCAAG
ACA
AGTATAACAGATAGCCGAGAAGAGGAGTGGTTGTCAGAGAGCGAGGATGGCTATGGTAGTACAGATT
CA
TTGGCTGCACATGTGAAGTACCTTCTGCAGTGTGAAACTTCACTGAATCAAGCCAAACAGATACTTAA
A
AATGCAGAGGAAGAGGAATATCGGGTCCGAACCCAAGCCTGGAATCTAAAGTTTAATTTAGGACGTGAC
CGT
GGATACTCCATTTCAGAATTAAATGAAGATGACAGAAGGAAAGTAGAAGAGATAAAAGCAAAGTTGT
TT
GGTCATGGAAGAGCAACTCACATGTCTGAGGGCTTACGAAGTCCACAAGGCATAGGATGTTTGCCAGA
A
GCTGTATGTAGTCGAATTATTATTGAGAGCCATGAGAAAGGATGTTTCAGGACTCTTACTGCTGAACAA
CCA
CGGCCAGACAGCTGCCATTGTGCTTTTCGATCTGTTGAACCTTCAGACTTGATTAGAGGACATCGGA
GC
CCATCATCATGGAGAGGCAGGCACATCAACCTTTCCAGATCAATAGAACAGAGCAATCCCTGTTTCAA
A
GTAGGGAGTTCCTTTCAGTTACAGAGTCATCCCCCATTTCAAAAACTTTTACCTGATGACATCAAAATT
AGC
AAGGGTGTTGGAATGCCAGTCCATGCATACATGGATCCCCAGCCATCAGAATTAGTAGAACCTACTT
GT
GTGCCAGCTAAAGAAATGGATTTTCCTTCCTCATCTCAAATACTGCCCCCTGAGCCCAAGAAGCAGTT
C
ACTACTGCCATCACTTTTTCTTCTCACGAACACTCTGAGTGCATTTCTGATTCCTCTGGTTGTAAGGTT
GGT
GTTACTGCAGATAGCCAGTGTAGTGGACCATCTTTAGGGGTATTTAAGCCTCATATCCCCGAAGAGC
AG
ATTTCTCCTAGAGATCTTAAACAGAAAACCTCTTTCCAGTCATCACTTGAAAGGCATGGTTCTACACC
G
GTGACTATTTTAGCTGATGGTAGTAGGCAAAGGCAAAAATTACCTGTTGATTTTGAGCATTCTCATCAA
AAA
GAAAAACTCTTACAAAGATTAGGTTTTAAAGTCAGCCATTCTGAACCCAATGTCAGTACAAATGTTA
GC
AATTTCAAGGGAGTTCAATTTTCTGGTAAGGATACCATTGTTAGCCAGGACAAACTAACTTCTACAGT
A
GAGGTAAAAGAGAAGAATGTAACTGTAACTCCTGATCTTCCTTCTTGCATTTTTCTTGAACAACCAGAG
CTC
TTTGAGGAAAGCCACACCCCACATACAGATCTTCAGATGAGAAAATACCCTTCTCCCTCTTGTCCAG
AA
ATTGCTTCTCGCATTTTTCTTGAGCAGCCAAAACTCTCTGAACAAAGCAAAGCCCCACATGTAGATCG
T
GAAATAAGAGAAGATCACTCTTTCTTTCCTAAGTGCCAGGATTATATAGTTGCAGACCCTTCTCCCGAT
TTT
CCTGATCAGCAACAATGCAAACCTCCAGACGTAGTTGGCCACACGAGAAAACAGAACTCTCTTCTTT
CT
GAAGGTCAGGATTATGAGTTAGAAGAGGTTCAGCATATACCTCAGTCATACTTTTCTAATATGGTAAA
T
GTTGAAGCCAAGGTCAGTGATGCGATCTCCCAGTCAGCCCCTGACCACTGTACAGCTGCATCTACTCCA
CCT
TCAAATAGAAAAGCACTTTCATGTGTTCGTATAACTCTTTGTCCCAAGACTTCTTCCAAGTTGGATA
GT
GGAACCTTAGGTGAAAGGTTTCATTCATTGGATCCTGCTTCTAAAACAAGGATTAATAGTGAGTTTAA
C
TCTGATCTGCGAATTATATCTTCAAGGTCATTGGAACCAACCTCCAAATTACTGACCTGTAAACCAGTA
GCA
CAGGATCAAGAATCTTTAGTTTTTCTAGGACCTAAATCTCCACTGGACTTGCAAGTCGCACAGTCTT
CT
CTTCCAGATAGTAAGACTATTTTTCAGGACTTGAAAACCAAACCTCCTCAGAATAGCCAGATAGTAAC
C
TCAAGGCAAACACAAGTGAACATTTCACATTTGGAAGGATATTCCAAACCAGAGGGGACTCCAGTATCT
GCG
GATGGTTCACAAGAACAGAGTAAGGTTTCCTTTACTACGTCCTTTGGAAAGTTATCATCTGATGCCA
TC
ACTCAGATAACAACAGAAAGTCCAGAAAAGACCACATTTTCATCTGAAATTTTTATTCATGCGGATGA
T
CGTGGACAGGGCATTCTAGACCCCATGGCCCAAAAGCCATCCAGGTTTGCCTCATCATCCTCAGTGCAG
CAA
ATCCCAGCTTCTCATGGCAAAGACGCCCAGCCTGTGCTGTTACCATATAAGCCATCTGGTAGTTCGA
AG
ATGTATTATGTTCCACTGTTAAAAAGAGTTCCTTCATATCTGGATTCCAAATCTGATACCACTGTTGA
G
AGCTCACATTCAGGCTCAAATGATGCTATTGCCCCAGACTTTCCACCTCAAATGCTAGGCACAAGAGAC
GAT
GACCTCTCCAACACTGTAAACATTAAGCACAAAGAAGGGATTTATAGCAAGAGGGCTGCAACAAAGG
GG
AAAAACCCCTCTCAGAAAGGTGATGCAGCGGCCCCAGTTCAAATGCCTATAACTTGGGATGAGAATGT
C
TTGGACGAAAACCAAGAAGAGGTCATCAGTAGAGGAGTTGTGATCAAGATGGCAGGACCTGAAGAAATG
TCA
TCCCTGGAGAAGGACCTTGCAGGTCCCAGTGATATCACTGTACAAGACAGAAAAACTGAAAATCTGC
CA
GACACTAAATCCATTAAACAGAAGGAAGGATCCTTAGAGATAGAATCTGAATGTCATTCTGCATTTGA
A
AACACTGCTCACTCTGTCTTCAGATCAGCCAAGTTTTATTTCCATCATCCAGTGCACCTGCCCCATGAG
CAA
GACTTCTGCCATGAATCTTTGGGAAGGAGTGTTTTCATGCAACATTCTTGGAAGGATTTCTTTCACC
AT
CATTCAGGACACAGCTGCCTTCCTCCCCCTGGCCCAAGTTCGGACAAGTTGGACAAGACCAAGATGGA
T
TACACCAGAATTAAGAGCCTCAGCATCAACTTGAATTTGGGAGAGCATGAGAAAATACATACTATCAAG
AAT
CAGGCCAGAGACCCAAAAGGCAAAAGACAAGCAAATGAGCAAAAGAAGGATCAGAAGGTCACCCCAG
AG
CTAACAACTGAGTGCCCCGTGAGTTTGAATGAACTCTGGAACAGATACCAGGAGCGACAGAAGCAGCA
G
AATCCATCTGGTGCTTGTGATACGAAAGAGCTCTCCTTGGTGGAACGACTTGATCGCTTGGCTAAACTG
CTT
CAGAATCCCATCACACATTCACTCCGGGCCTCAGAAAGTGCACAGGATGATAGCAGAGGGGGACATA
GA
GCCAGGGAGTGGACTGGGAGGAGGCAACAAAAACAGAAAGGCAAGCAACACAGGAAGTGGAGTAAGAG
C
CTAGAGAGGGGCCAGAGTACAGGGGACTTTAGGAAAAGCAAAGTGTTTTCTCCTCATCAAGGTGGGAAA
TCC
AGTCAGTTCAAGATTGAGCAGATTAAACTAGATAAGTACATCCTGAGGAAAGAGCCAGGTTTTAATA
AT
GTCAGCAATACCTCCTTGGATTCTAGACCCTCAGAGGAAAGCGTGTCTCTCACAGATAGTCCCAACAT
T
TTTTCTAGCACGGATTCTCCTGTGGACTCAGATGTATTGACCCCAACTGATAGGGACATGCCTTTAAAT
GAG
AGGAGCAGCTCCATATCCACCATTGACACAGTCCGGTTGATCCAGGCTTTTGGCCAAGATAGACTGT
CT
TTGTCGCCCAGGCGAATTAAATTATACAGTACTGTCACTAGTCAACGGAGGAGATATCTGGAGCAGCC
A
TGCAAGCACAACAGGAAGGCATTGAACACAGCCTGTCCCCAAATGACTTCTGAGCACAGCAGAAGGAGG
CAC
ATCCAGGTGGCAAACCATATGACTTCTTCTGACTCTGTTTCATCTCCTGGGAGCTTGTTGAGCTTGG
AC
TCTGCTCTTTCCAATGAGGAAACTGTACGCATGGTGAGCAAGGGTGTACAAGCTGGTAACTTGGAGAT
T
GTGGCTGGTGTCAAAAAATACACTCAGGATGTTGGGGTGACTTTCCCAACTCCCAGTTCTAGTGAGGCC
AGA
TTGGAAGAGGACAGTGATGTGACTTCTTCGTCAGAAGAAAAAGCCAAAGAGAAAAAGTTTCTTTCCA
AT
TATCTGCAGACCAAAAACTTAAGGAAGAACAAGCCAAATCCCTGTGCAGGAGTCTCATGGTTTGTTCC
T
GTGGAAAGTGGACAATCAGGATCTAAGAAGGAAAACCTGCCCAAGATTTACAGACCTGTTATCTCCTGG
TTT
GAACCAGTAACCAAAACCAAACCCTGGAGGGAGCCACTGAGGGAACAAAACTGGCAGGCCCAATGCA
TG
AACAGTCGTGGGTCCCTGGGAGGCCCAGGCAGGGATAGTGGCCAGGTTTCTCTTCGGCCATTTGTGAG
A
GCAACTCTGCAGGAATCACTTCAGCTTCACAGACCTGATTTCATCTCCCACTCTGGGGAGCGCATAAAG
CGT
CTGAAGTTACTTGTCCAGGAGAGGAAGCTCCAGAGCCTGTTCCAGAGTGAGCGGGAGGCTCTGTTCC
AC
TCAGCGAGGCCCCTGCCCAGGAGAGTCCTCCTGGCTGTCCAGAAGAACAAGCCTATTGGAAAGAAGGA
A
ATGATTCAGAGGACCAGACGAATTTATGAGCAGCTTCCAGAAGTGAAGAAGAAGAGAGAAGAGGAGAAG
AGA
AAATCAGAATATAAATCCTACTGGCTACGTGCTCAACACTATAAAATGAAAGTGACCAATCATCTCC
TG
GGGAGAAAAGTGCCTTGGGACTGA


Translation (3251 aa):
MEPEDLPWPDELEEEEEEEEEEGEEEEGKKEVENASAAATEEALTSEESGRLEEFEEAGPDLDFNYESQR
Q
ESSDEEEDELAKAWLQAHPDRPGSAFSLPPPTPPPPPPPLSPRLRYTPVEHLGKTE
VVPLTCRVWQQSS
Y
QDNSRAQFSNSSTMLLETGVRWGSEEDQ
RTESWHCLPQERDSSQTLAMSQTEIGRVEGTEVPDLPSQEG
G
LPAQSQCPGKKPKLNVLCSPLL
VIQDNFAAPDLPLLTCLIQDQEEVEPDSLFQQSELEFAPLRGIPDKS
E
DSEWLARPSEVSEALIQATSETSSDLANSCFSISQHPLT
EGLQGKAESGVLTRCGDAKYSSLYENLGAQ
S
ERIAVLQRE
VGCSNLGISQASPSSLPSFVPQEPTSEPEYHSSNLRMLRVSPDTLLTTHTHSAGSADQKI
G
AAVVSSAYSQEIKPGSFHQEELPDRHLNEEIRKVSPALRTAGQKPEMLPVQSSSYSKGMKSIFYQHPVS
H
GHQGKEPLSVSAVCGSAGNKAFHQLSTLSDSLLTEETWPVSVIPGLGNQKTPLPSEFSLSYSHRGKNLP
E
DVVKVSTDSGSAHKKADILTASSRTYQHKMKPANIYHQELPDSRVPIGTRKVAFESGPAGQKSGVSHPY
G
EMPSVFYQQGLPDRHSAKSPTKTFIPGPADQKTDLSPVPPTSSSHAEKPVSPYQLTLPGSHLPEDVFKA
S
SVCKSSDELSGITALTSASYSYKGRPNSSYQQKFPDSHLNEEAQKILGTTGTVDQKTVTPTMSSSFLQK
E
KPSIFYQQTLPDGGLSEEDLQVSAVPWPADQNIAIPTVTSAAFSQREKPRIFYQQTLSVDRLPGEPLNV
L
GTSGPPDQNTGAPTVTPSSYFPGEESIIFYQAGFPGNTLSAMSFKVPRISGSTEQTNVTTGSSSSYSVG
E
KSIIFYHQALPDGRLPQEASPAPADLNTGEPPMYLASCSVGVKPIIFYQQPMSDSQRTKGHKESDVPGP
T
DQKTGIATVHSTSQSYIGRRTVSYQKEFPDLSEKALKVLGDVGSTEQKTQIPVVSSALLHKEGPSAYQE
D
LPDLTEEPLQILGVSEEVSSSSYQRKLPDHIEVFLKSVGSGSADRKTGAQIVSSSREKSSGFHQQELPN
T
GGDAVDAFHPEPVVQEVRKVQTPGAPAGPSSSHFHKEKLSDYQKASPHRDLTESSLKASTVPGLSDQKK
K
PAVSSGFCLHKEKHEISASALLNCQTAELLTVTQRSCLHREDPAISTVIKPDDQKIPLPTTFHGSSDQK
V
KPVIFVQKQLRDRDQSEDIPKISTVSEPTVVNTVLPVLLPGSYSHREKSDSFYPQELPDGHLTEVDLKV
S
SGLGQADQISGLPTGIPGTYSHSEKHQLISEHVQELMDNLNSSESSCLSVDSMPLNSQIDDGVIICKPE
S
LGFANAGCEEMQNIDRGSKTLKEIQTLLMEAENMALKRCNFSVPLVPFRDVNDVSFIRSKKVVCFKESS
T
TDVCTQRESFVEEVPHIEYVQKDIGTQTNLKYQRGVGNWEFISSATFRSPLQEAEGTARMAYDETFRQY
K
AARSVMRSEPEGCSTGIGNKMIIPMMTIIKSDSSSDVSDGCCSWDNNLPESLESVSDVFLNFFPYTSPK
T
SITDSREEEWLSESEDGYGSTDSLAAHVKYLLQCETSLNQAKQILKNAEEEEYRVRTQ
AWNLKFNLGRD
R
GYSISELNEDDRRKVEEIKAKLFGHGRATHMSE
GLRSPQGIGCLPEAVCSRIIIESHEKGCFRTLTAEQ
P
RPDSCHCAFRSVEPSDLIRGHRSPSSWRGRHINLSRSIEQSNPCFKVGSSFQLQSHPPFQKLLPDDIKI
S
KGVGMPVHAYMDPQPSELVEPTCVPAKEMDFPSSSQILPPEPKKQFTTAITFSSHEHSECISDSSGCKV
G
VTADSQCSGPSLGVFKPHIPEEQISPRDLKQKTSFQSSLERHGSTPVTILADGSRQRQKLPVDFEHSHQ
K
EKLLQRLGFKVSHSEPNVSTNVSNFKGVQFSGKDTIVSQDKLTSTVEVKEKNVTVTPDLPSCIFLEQPE
L
FEESHTPHTDLQMRKYPSPSCPEIASRIFLEQPKLSEQSKAPHVDREIREDHSFFPKCQDYIVADPSPD
F
PDQQQCKPPDVVGHTRKQNSLLSEGQDYELEEVQHIPQSYFSNMVNVEAKVSDAISQSAPDHCTAASTP
P
SNRKALSCVRITLCPKTSSKLDSGTLGERFHSLDPASKTRINSEFNSDLRIISSRSLEPTSKLLTCKPV
A
QDQESLVFLGPKSPLDLQVAQSSLPDSKTIFQDLKTKPPQNSQIVTSRQTQVNISHLEGYSKPEGTPVS
A
D
GSQEQSKVSFTTSFGKLSSDAITQITTESPEKTTFSSEIFIHADDRGQGILDPMAQKPSRFASSSSVQ
Q
IPASHGKD
AQPVLLPYKPSGSSKMYYVPLLKRVPSYLDSKSDTTVESSHSGSNDAIAPDFPPQMLGTRD
D
DLSNTVNIKHKEGIYSKRAATKGKNPSQKGDA
AAPVQMPITWDENVLDENQEEVISRGVVIKMAGPEEM
S
SLEKDLA
GPSDITVQDRKTENLPDTKSIKQKEGSLEIESECHSAFENTAHSVFRSAKFYFHHPVHLPHE
Q
DFCHESLGRSVFMQHSWKDFFHHHSGHSCLPPPGPSSDKLDKTKMDYTRIKSLSINLNLGEHEKIHTIK
N
QARDPKGKRQANEQKKDQKVTPELTTECPVSLNELWNRYQERQKQQNPSGACDTKELSLVERLDRLAKL
L
QNPITHSLRASESAQDDSRGGHRAREWTGRRQQKQKGKQHRKWSKSLERGQSTGDFRKSKVFSPHQGGK
S
SQFKIEQIKLDKYILRKEPGFNNVSNTSLDSRPSEESVSLTDSPNIFSSTDSPVDSDVLTPTDRDMPLN
E
RSSSISTIDTVRLIQAFGQDRLSLSPRRIKLYSTVTSQRRRYLEQPCKHNRKALNTACPQMTSEHSRRR
H
IQ
VANHMTSSDSVSSPGSLLSLDSALSNEETVRMVSKGVQAGNLEIVAGVKKYTQDVGVTFPTPSSSEA
R
LEEDSDVTSSSEEKAKEKKFLSNYLQTKNLRKNKPNPCA
GVSWFVPVESGQSGSKKENLPKIYRPVISW
F
EPVTKTKPWREPLREQNWQAQCMNSRGSLGGPGRDSGQVSLRPFVRATLQ
ESLQLHRPDFISHSGERIK
R
LKLLVQERKLQSLFQSEREALFHSARPLPRR
VLLAVQKNKPIGKKEMIQRTRRIYEQLPEVKKKREEEK
R
KSEYKSYWLRAQHYKM
KVTNHLLGRKVPWD



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser