NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS20203.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20203.1 Public Mus musculus 6 Atoh1 16 104 75 CCDS HistoryNCBI Gene:11921Re-query CCDS DB by CCDS ID:20203.1Re-query CCDS DB by GeneID:11921

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 20203.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101351 ENSMUSP00000098903 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101351Link to Ensembl Protein Viewer:ENSMUSP00000098903Re-query CCDS DB by Nucleotide ID:ENSMUST00000101351Re-query CCDS DB by Protein ID:ENSMUSP00000098903
Original member Current member NCBI NM_007500.4 NP_031526.1 Accepted alive Link to Nucleotide Sequence:NM_007500.4Link to Protein Sequence:NP_031526.1Re-query CCDS DB by Nucleotide ID:NM_007500Re-query CCDS DB by Protein ID:NP_031526Link to BLink:NP_031526.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031526.1 351 P48985 351 100% 0 0

Chromosomal Locations for CCDS 20203.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

Chromosome Start Stop Links
6 64729323 64730378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1056 nt):
ATGTCCCGCCTGCTGCATGCAGAAGAGTGGGCTGAGGTAAAAGAGTTGGGGGACCACCATCGCCATCCCC
AG
CCGCACCACGTCCCGCCGCTGACGCCACAGCCACCTGCTACCCTGCAGGCGAGAGACCTTCCCGTCTA
C
CCGGCAGAACTGTCCCTCCTGGATAGCACCGACCCACGCGCCTGGCTGACTCCCACTTTGCAGGGCCTC
TGC
ACGGCACGCGCCGCCCAGTATCTGCTGCATTCTCCCGAGCTGGGTGCCTCCGAGGCCGCGGCGCCCC
GG
GACGAGGCTGACAGCCAGGGTGAGCTGGTAAGGAGAAGCGGCTGTGGCGGCCTCAGCAAGAGCCCCGG
G
CCCGTCAAAGTACGGGAACAGCTGTGCAAGCTGAAGGGTGGGGTTGTAGTGGACGAGCTTGGCTGCAGC
CGC
CAGCGAGCCCCTTCCAGCAAACAGGTGAATGGGGTACAGAAGCAAAGGAGGCTGGCAGCAAACGCAA
GG
GAACGGCGCAGGATGCACGGGCTGAACCACGCCTTCGACCAGCTGCGCAACGTTATCCCGTCCTTCAA
C
AACGACAAGAAGCTGTCCAAATATGAGACCCTACAGATGGCCCAGATCTACATCAACGCTCTGTCGGAG
TTG
CTGCAGACTCCCAATGTCGGAGAGCAACCGCCGCCGCCCACAGCTTCCTGCAAAAATGACCACCATC
AC
CTTCGCACCGCCTCCTCCTATGAAGGAGGTGCGGGCGCCTCTGCGGTAGCTGGGGCTCAGCCAGCCCC
G
GGAGGGGGCCCGAGACCTACCCCGCCCGGGCCTTGCCGGACTCGCTTCTCAGGCCCAGCTTCCTCTGGG
GGT
TACTCGGTGCAGCTGGACGCTTTGCACTTCCCAGCCTTCGAGGACAGGGCCCTAACAGCGATGATGG
CA
CAGAAGGACCTGTCGCCTTCGCTGCCCGGGGGCATCCTGCAGCCTGTACAGGAGGACAACAGCAAAAC
A
TCTCCCAGATCCCACAGAAGTGACGGAGAGTTTTCCCCCCACTCTCATTACAGTGACTCTGATGAGGCC
AGT
TAG


Translation (351 aa):
MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGL
C
TARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCS
R
QRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSE
L
LQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSG
G
YSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEA
S




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser