NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
AUG-guidelines

Collaborators
EBI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19566.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19566.1 Public Mus musculus 5 Mvk 16 104 75 CCDS HistoryNCBI Gene:17855Re-query CCDS DB by CCDS ID:19566.1Re-query CCDS DB by GeneID:17855

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19566.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043760 ENSMUSP00000036971 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043760Link to Ensembl Protein Viewer:ENSMUSP00000036971Re-query CCDS DB by Nucleotide ID:ENSMUST00000043760Re-query CCDS DB by Protein ID:ENSMUSP00000036971
Original member Current member EBI,WTSI OTTMUST00000034379 OTTMUSP00000015400 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034379Link to Vega Protein Viewer:OTTMUSP00000015400Re-query CCDS DB by Nucleotide ID:OTTMUST00000034379Re-query CCDS DB by Protein ID:OTTMUSP00000015400
Original member Current member NCBI NM_023556.2 NP_076045.1 Accepted alive Link to Nucleotide Sequence:NM_023556.2Link to Protein Sequence:NP_076045.1Re-query CCDS DB by Nucleotide ID:NM_023556Re-query CCDS DB by Protein ID:NP_076045Link to BLink:NP_076045.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_076045.1 395 Q9R008 395 100% 0 0

Chromosomal Locations for CCDS 19566.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 114445402 114445479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114446159 114446306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114450277 114450421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114450706 114450861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114452365 114452468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114452880 114452925 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114455397 114455487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114455890 114456006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114458895 114459048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 114460043 114460191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1188 nt):
ATGTTGTCAGAAGCCCTGCTGGTGTCCGCCCCGGGGAAGGTCATCCTCCATGGAGAACACGCTGTGGTCC
AT
GGCAAGGTCGCTCTGGCAGCGGCCTTGAACTTGAGAACTTTCCTCCTGCTGCGACCGCAGAGCAATGG
G
AAAGTGAGCGTCAATTTACCCAACATCGGTATTAAGCAGGTGTGGGATGTGGGCATGCTTCAGCGACTG
GAC
ACGAGCTTTCTTGAGCAAGGTGATGTCTCGGTACCCACCTTGGAGCAACTGGAGAAGCTAAAGAAGA
TG
GGGGACCTCCCCAGAGACCGTGCAGGCAATGAAGGCATGGCTCTGCTTGCCTTTCTCTACCTGTACCT
G
GCAATCTGCCGGAAGCAGAGGACACTCCCGAGCCTGGACATGGTGGTGTGGTCGGAACTTCCCCCCGGG
GCA
GGCTTGGGCTCCAGCGCCGCCTACTCTGTGTGTCTGGCAGCCGCCCTCCTGACTGCCTGTGAGGAGG
TC
TCCAACCCGCTCAAGGACGGGGTCTCCGTCAGCAGGTGGCCCGAGGAAGATCTGAAGTCAATCAACAA
G
TGGGCCTTCGAAGGGGAGAGAGTGATCCATGGGAACCCTTCTGGTGTGGACAATGCCGTCAGCACCTGG
G
GC
GGAGCCCTGCGCTTCCAGCAAGGGACGATGTCTTCCTTGAAGAGCCTCCCGTCTCTGCAGATCCTGC
TC
ACCAACACCAAGGTCCCGCGGAGTACCAAGGCCCTTGTGGCTGCTGTCAGAAGCAGGCTGACCAAGTT
C
CCTGAGATTGTGGCCCCGCTGCTGACCTCCATTGACGCAATATCCCTGGAGTGTGAGCGCGTGCTAGGG
GAG
ATGGTGGCAGCTCCAGTTCCGGAACAGTACCTCGTACTAGAAGAGCTGATAGACATGAACCAGCACC
AT
CTGAATGCTCTCGGGGTGGGCCACAACTCCCTGGACCAGCTCTGCCAAGTAACGGCAGCACACGGACT
G
CACAGCAAGCTGACGGGCGCTGGCGGTGGCGGCTGTGGCATCACCCTCCTGAAGCCAGGTCTAGAGCAA
GCC
ACAGTGGAGGCAGCCAAGCAGGCCCTGACCAGCTGCGGGTTTGACTGCTGGGAGACCAGCATCGGCG
CA
CCCGGAGTTTCCACACACTCAGCTGCAGCTGTAGGGGACCCTGTCCGACAAGCCCTGGGCCTCTGA


Translation (395 aa):
MLSEALLVSAPGKVILHGEHAVVHGKVALAAALNLRTFLLLRPQSNGKVSVNLPNIGIKQVWDVGMLQRL
D
TSFL
EQGDVSVPTLEQLEKLKKMGDLPRDRAGNEGMALLAFLYLYLAICRKQRTLPSLDMVVWSELPPG
A
GLGSSAAYSVCLAAALLTACEEVSNPLKDGVSVS
RWPEEDLKSINKWAFEGERVIHGNPSGVDNAVSTW
G
GALRFQQGTMSSLKSLPSLQILLTNTKVPRSTKALVAAVRSRLTKFPEIVAPLLTSIDAISLECERVLG
E
MVAAPVPEQYLVLE
ELIDMNQHHLNALGVGHNSLDQLCQVTAAHGLHSKLTGAGGGGCGITLLKPGLEQ
A
TVEAAKQALTSCGFDCWETSIGAPGVSTHSAAAVGDPVRQALGL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser