NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19552.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19552.1 Public Mus musculus 5 Sart3 19 105 81 CCDS HistoryNCBI Gene:53890Re-query CCDS DB by CCDS ID:19552.1Re-query CCDS DB by GeneID:53890See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19552.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000019118 ENSMUSP00000019118 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019118Link to Ensembl Protein Viewer:ENSMUSP00000019118Re-query CCDS DB by Nucleotide ID:ENSMUST00000019118Re-query CCDS DB by Protein ID:ENSMUSP00000019118
Original member Current member EBI,WTSI OTTMUST00000135131 OTTMUSP00000071570 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000135131Link to Vega Protein Viewer:OTTMUSP00000071570Re-query CCDS DB by Nucleotide ID:OTTMUST00000135131Re-query CCDS DB by Protein ID:OTTMUSP00000071570
Original member Current member NCBI NM_016926.1 NP_058622.1 Accepted alive Link to Nucleotide Sequence:NM_016926.1Link to Protein Sequence:NP_058622.1Re-query CCDS DB by Nucleotide ID:NM_016926Re-query CCDS DB by Protein ID:NP_058622Link to BLink:NP_058622.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058622.1 962 Q9JLI8-1 962 100% 0 0

Chromosomal Locations for CCDS 19552.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 113743129 113743303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113744544 113744734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113745047 113745199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113745580 113746031 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113746624 113746792 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113747923 113747999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113748762 113748874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113751203 113751312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113752214 113752272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113752391 113752468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113753598 113753705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113754233 113754371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113755370 113755525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113758139 113758263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113759221 113759272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113761095 113761279 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113762829 113762933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113764073 113764199 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 113771321 113771635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2889 nt):
ATGGCGACGACGGCCGCATCTTCGGCGTCCGAGCCGGAGGTTGAGCCCCAGGCCGGGCCTGAGGCCGAGG
GA
GAAGAGGATGAGGCGAAGCCGGCCGGTGTGCAGCGGAAGGTGCTGTCCGGCGCTGTGGCCGCGGAGGC
G
GCGGAGGCCAAGGGCCCCGGATGGGACCTGCAGCGGGAAGGCGCGAGCGGGAGCGATGGGGATGAGGAG
GAC
GCCATGGCTTCCTCCGCCGAGAGCTCCGCCGGGGAGGACGAGTGGGAGTACGACGAGGAGGAGGAGA
AG
AACCAGCTGGAGATCGAGCGGCTGGAGGAGCAGCTGTCCATCAATGGCTATGATTACAACTGCCACGT
G
GAGCTCATCAGGCTGCTGCGGCTGGAAGGCGAGCTCAGCAGAGTGAGGGCGGCCCGCCAGAAGATGAGT
GAG
CTCTTCCCCCTGACCGAAGAGCTCTGGCTGGAGTGGCTCCACGATGAGATCAGCATGGCCATGGACG
GC
CTGGACCGCGAGCACGTGTACGAGCTCTTTGAGAGAGCCGTGAAGGACTACATCTGTCCAAACATTTG
G
CTAGAGTATGGCCAGTACTCAGTTGGTGGCATTGGTCAGAAAGGTGGCCTTGAGAAGGTTCGCTCTGTC
TTT
GAAAGAGCCCTGTCCTCTGTTGGCCTGCACATGACGAAAGGCCTGGCCATCTGGGAGGCCTACCGAG
AG
TTTGAAAGCGCCATCGTGGAGGCTGCTCGGCTGGAGAAAGTGCACAGTCTCTTCCGGCGACAGCTGGC
G
ATCCCACTGTACGAGATGGAGGCCACCTTTGCAGAGTATGAAGAATGGTCAGAGGAGCCCATGCCGGAG
TCT
GTACTTCAGAGCTATCAGAAAGCGCTGGGGCAGCTAGAGAAGTACAAGCCTTACGAGGAAGCGCTGC
TG
CAGGCAGAGGCCCCTCGGCTGGCGGAATACCAAGCTTACATCGACTTCGAGATGAAAATCGGGGATCC
T
GCCCGTATTCAGTTGATCTTTGAGCGTGCCCTGGTGGAGAACTGCCTGGTTCCAGACTTATGGATCCGC
TAC
AGTCAGTACCTAGATCGACAGCTGAAAGTTAAGGACTTGGTTTTATCTGTACACAGCCGTGCTGTGC
GG
AACTGCCCATGGACAGTTGCCCTGTGGAGTCGGTACCTTCTGGCCATGGAGCGACATGGACTGGACCA
T
CAAACGATTTCTGCGACCTTCGAGAACGCTCTGAGTGCCGGCTTCATCCAGGCCACTGACTATGTGGAG
ATC
TGGCAGGTGTACCTCGACTACCTGAGGAGAAGGGTTGACTTCAGACAGGACTCTAGCAAGGAGCTGG
AA
GAGCTGCGGTCCATGTTCACGCGAGCTCTGGAGTACCTGCAGCAGGAGGTTGAGGAGCGTTTCAGCGA
G
AGTGGGGATCCAAGCTGCCTGATCATGCAGAGCTGGGCTCGGGTTGAGGCTCGCCTGTGCAATAACATG
CAG
AAAGCCCGAGAGCTCTGGGACAGCATCATGACCAGAGGGAATGCCAAGTACGCCAACATGTGGCTGG
AG
TATTACAACCTGGAACGGGCACACGGTGACACACAACACTGTCGGAAGGCTCTGCACCGAGCTGTCCA
G
TGCACGAGTGACTACCCTGAGCACGTCTGTGAAGTGTTGCTCACCATGGAGAGGACAGAAGGGACCTTA
GAA
GATTGGGATCTAGCCATTCAGAAAACGGAGACGCGCTTGGCTCGTGTGAATGAGCAGAGAATGAAGG
CC
GCAGAGAAGGAAGCAGCTCTTGTGCAGCAGGAAGAAGAAAAGGCCGAGCAGCGGAAGAAGGTGCGGGC
G
GAGAAGAAAGCCCTGAAAAAGAAGAAGAAAACGCGAGGTGCCGACAAGCGCAGGGAGGACGAGGACGAG
GAG
AACGAGTGGGGCGAAGAGGAGGAAGAGCAGCCTTCCAAACGCAGAAGGACGGAGAACAGTCTGGCCT
CT
GGAGAGGCTTCGGCTATGAAGGAAGAAACAGAGCTCTCCGGGAAATGCTTAACGATAGATGTTGGTCC
T
CCTTCCAAGCAGAAAGAGAAGGCAGCCTCCCTTAAGCGGGACATGCCCAAGGTGGCTCACGACAGCAGT
AAG
GACAGTGTCACCGTGTTTGTCAGCAACCTGCCCTACAGCATAGAAGAGCCCGAGGTGAAGCTCAGGC
CG
CTCTTTGAGGTCTGTGGGGAGGTGGTCCAGATCAGGCCAATTTTCAGCAACCGCGGGGACTTCCGGGG
C
TACTGCTATGTGGAGTTTGGAGAGGAGAAGTCAGCCCAGCAGGCCCTGGAGCTGGACAGGAAGATTGTG
GAG
GGCAGGCCGATGTTTGTGTCCCCCTGTGTGGATAAGAGCAAAAACCCTGATTTTAAGGTGTTCAGAT
AC
AGTACCACCCTGGAGAAACACAAACTCTTCATCTCTGGCCTGCCCTTTTCCTGCACCAAAGAGGAGCT
C
GAGGACATTTGTAAGGCCCACGGCACCGTCAAGGACCTCAGGCTGGTCACTAACAGGGCTGGCAAGCCG
AAG
GGCCTGGCGTATGTGGAGTATGAAAACGAGTCCCAGGCGTCCCAGGCAGTGATGAAGATGGACGGCA
TG
ACCATCAGAGAGAATGTCATCAAGGTGGCAATCAGCAATCCCCCTCAGCGAAAAGTCCCAGAGAAGCC
A
GAAGTGAGGACAGCACCAGGGGCCCCCATGCTCCCCCGGCAGATGTATGGCGCGCGCGGGAAGGGACGG
ACC
CAGCTCTCTCTTCTTCCTCGAGCTCTGCAGCGCCAGGGTGCTGCTCCTCAGGCTGAGAACGGCCCAG
CT
CCGGGGCCCGCGGTCGCCCCGTCTGTGGCCACAGAGGCTCCTAAGATGTCCAATGCTGATTTTGCGAA
G
TTGCTTCTGAGAAAGTGA


Translation (962 aa):
MATTAASSASEPEVEPQAGPEAEGEEDEAKPAGVQRKVLSGAVAAEAAEAKGPGWDLQREGASGSDGDEE
D
AMASSAESSAGEDEWEYDEEEEKNQLEIERLEEQ
LSINGYDYNCHVELIRLLRLEGELSRVRAARQKMS
E
LFPLTE
ELWLEWLHDEISMAMDGLDREHVYELFERAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSV
F
ERALSSVGLHMTKGLAIWEAYREFESAIVEAAR
LEKVHSLFRRQLAIPLYEMEATFAEYEEWSEEPMPE
S
VLQSYQKALGQLEKYKPYEEAL
LQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIR
Y
SQYL
DRQLKVKDLVLSVHSRAVRNCPWTVALWSRYLLAMERHGLDHQTISATFENALSAGFIQATDYVE
I
WQVYLDYLRRRVDFRQ
DSSKELEELRSMFTRALEYLQQEVEERFSESGDPSCLIMQSWARVEARLCNNM
Q
KARELWDSIMTRGNAKYANMWLEYYNLE
RAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGTL
E
DWDLAIQKTETRLARVNEQRMK
AAEKEAALVQQEEEKAEQRKKVRAEKKALKKKKKTRGADKRREDEDE
E
NEWGEEEE
EQPSKRRRTENSLASGEASAMKEETELSGKCLTIDVGPPSKQKEKAASLKRDMPKVAHDSS
K
DSVTVFVSNLPYSIEEPEVKLRPLFEVCGEVVQIRPIFSNRGDFRGYCYVEFGEEKSAQQALELDRKIV
E
GRPMFVSPCVDKSKNPDFK
VFRYSTTLEKHKLFISGLPFSCTKEELEDICKAHGTVKDLRLVTNRAGKP
K
GLAYVEYENESQASQAVMKMDGMTIRENVIKVAISNPPQRKVPEKPEVRTAPGAPMLPRQMYGARGKGR
T
QLSLLPRALQRQGAAPQAENGPAPGPAVAPSVATEAPKMSNADFAKLLLRK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser