NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19530.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19530.1 Public Mus musculus 5 Pus1 16 104 75 CCDS HistoryNCBI Gene:56361Re-query CCDS DB by CCDS ID:19530.1Re-query CCDS DB by GeneID:56361See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19530.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000086643 ENSMUSP00000083844 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000086643Link to Ensembl Protein Viewer:ENSMUSP00000083844Re-query CCDS DB by Nucleotide ID:ENSMUST00000086643Re-query CCDS DB by Protein ID:ENSMUSP00000083844
Original member Current member EBI,WTSI OTTMUST00000057852 OTTMUSP00000027966 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057852Link to Vega Protein Viewer:OTTMUSP00000027966Re-query CCDS DB by Nucleotide ID:OTTMUST00000057852Re-query CCDS DB by Protein ID:OTTMUSP00000027966
Original member Current member NCBI NM_001025561.3 NP_001020732.1 Accepted alive Link to Nucleotide Sequence:NM_001025561.3Link to Protein Sequence:NP_001020732.1Re-query CCDS DB by Nucleotide ID:NM_001025561Re-query CCDS DB by Protein ID:NP_001020732Link to BLink:NP_001020732.1

Chromosomal Locations for CCDS 19530.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 110773932 110773979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 110774522 110775213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 110775536 110775638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 110776554 110776607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 110777614 110777751 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 110779687 110779897 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 110780240 110780319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1326 nt):
ATGGGCTTCCCCCGCCTGTGGGCCGCACTGCTGAGAAACTGGGGACGGTGGACGGCGCGCCCAGGCCCGC
GC
GTGCCCGGCCTGCCGCCTATGGCTGGAAACAAGGTGCCACCAGCGCTGGCCTCACACCAACCGGACAG
G
AAGGGCCGAGGTGGCTGGGTCTGGGAGGAGACGGAGCATCCTGCAAAGAGGGTCAAGGGCGGCGAGGAT
GAA
GAGCCCCCACGCAAGCTGCCAAAGCGAAAAATTGTGCTGCTCATGGCCTACTCGGGCAAGGGCTACC
AC
GGCATGCAGAGGAATCTGGGGTCCTCCCAGTTCAGGACCATCGAAGATGACTTGGTATCGGCCTTAGT
C
CAGGCAGGTTGTATCCCTGAAAACCATGGCACAGATATGAGGAAGATGTCCTTCCAGCGGTGTGCTCGA
ACA
GACAAGCCTTTGAGGACCTCTGCCTGCTTTTGCCTGTACACTGGCTTCCTCTTCCACTGGGGTGTGT
CT
GCAGCAGGGCAGGTGGTATCCCTAAAGGTGTGGCTGATTGATGACATTCTGGACAAGATCAACAGCCA
C
CTTCCATCCCACATTCGGATTCTGGGATTGAAGAGGGTCACAGGCGGGTTCAACTCCAAGAACAAGTGT
GAC
GCCAGGACCTACTGCTACATGCTGCCCACCTTTGCCTTTGCTCACAAGGACCGGGATGTACAGGACG
AG
AGCTATCGCCTGAGTGCAGAGACCCTGCAGCAGGTCAACCGCCTTCTGGCCTGCTACAAAGGCACCCA
T
AACTTCCATAACTTCACCTCGCAGAAGGGCCCAAGAGAGCCCAGTGCGCGCCGCTACATTCTGGAGATG
TAC
TGCGAAGAGCCCTTCGTACGTGAGGGCCTGGAGTTTGCTGTGATCAAGGTGAAGGGCCAGAGCTTCA
TG
ATGCACCAGATCCGGAAGATGGTTGGCCTGGTGGTAGCCATTGTGAAGGGTTATGCCCCTGAGAGTGT
C
CTGGAGCGCAGCTGGGGAGAGGAGAAGGTGGATGTGCCCAAGGCACCCGGGCTTGGCTTAGTCCTGGAG
AGG
GTTCACTTTGAAAAGTACAATCAACGCTTTGGCGGTGACGGGCTGCATGAGCCCCTGGACTGGACGC
AG
GAGGAAGGGAAGGTGACTGCTTTCAAGGAGCAGTACATTTACCCTACCATTGTCAGCACTGAGCGGGA
T
GAGCGGTCCATGGCCCAGTGGCTCAATACTTTGCCGATCCACAACTTCAGTGGCACTGCACTTGGAGCG
GCT
GACACAGGTGCCAAGGTCCCCAGTTCCCTGGAGGGCAGTGAAGGGGATGGAGACACTGACTGA


Translation (441 aa):
MGFPRLWAALLRNWGRWTARPGPRVPGLPPMAGNKVPPALASHQPDRKGRGGWVWEETEHPAKRVKGGED
E
EPPRKLPKRKIVLLMAYSGKGYHGMQ
RNLGSSQFRTIEDDLVSALVQAGCIPENHGTDMRKMSFQRCAR
T
DK
PLRTSACFCLYTGFLFHWGVSAAGQVVSLKVWLIDDILDKINSHLPSHIRILGLKRVTGGFNSKNKC
D
ARTYCYMLPTFAFAHKDRDVQDESYRLSAETLQQVNRLLACYKGTHNFHNFTSQKGPREPSARRYILEM
Y
CEEPFVREGLEFAVIKVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGEEKVDVPKAPGLGLVLE
R
VHFEKYNQRFGGDGLHEPLDWTQEEGKVTAFKEQYIYPTIVSTERDERSMAQWLNTLPIHNFSGTALGA
A
DTGAK
VPSSLEGSEGDGDTD



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser