NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19316.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19316.1 Public Mus musculus 5 Phox2b 16 104 75 CCDS HistoryNCBI Gene:18935Re-query CCDS DB by CCDS ID:19316.1Re-query CCDS DB by GeneID:18935See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19316.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000012664 ENSMUSP00000012664 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000012664Link to Ensembl Protein Viewer:ENSMUSP00000012664Re-query CCDS DB by Nucleotide ID:ENSMUST00000012664Re-query CCDS DB by Protein ID:ENSMUSP00000012664
Original member Current member EBI,WTSI OTTMUST00000097414 OTTMUSP00000054637 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000097414Link to Vega Protein Viewer:OTTMUSP00000054637Re-query CCDS DB by Nucleotide ID:OTTMUST00000097414Re-query CCDS DB by Protein ID:OTTMUSP00000054637
Original member Current member NCBI NM_008888.3 NP_032914.1 Accepted alive Link to Nucleotide Sequence:NM_008888.3Link to Protein Sequence:NP_032914.1Re-query CCDS DB by Nucleotide ID:NM_008888Re-query CCDS DB by Protein ID:NP_032914Link to BLink:NP_032914.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032914.1 314 O35690 314 100% 0 0

Chromosomal Locations for CCDS 19316.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 67096107 67096622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 67097676 67097863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 67098701 67098941 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (945 nt):
ATGTATAAAATGGAATATTCTTACCTCAATTCCTCTGCCTACGAGTCCTGTATGGCCGGGATGGATACCT
CC
AGCTTGGCTTCAGCATATGCAGACTTCAGTTCCTGCAGCCAGGCCAGTGGCTTCCAGTATAACCCGAT
A
AGGACCACTTTTGGGGCCACGTCCGGTTGCCCGTCCCTCACGCCGGGATCCTGCAGCCTGGGCACCCTC
AGG
GACCACCAGAGCAGTCCGTACGCCGCAGTTCCATACAAACTCTTCACCGACCACGGCGGCCTCAACG
AG
AAACGCAAGCAGCGGCGCATCCGCACCACCTTCACAAGCGCGCAGCTCAAAGAGTTGGAGAGGGTCTT
C
GCTGAGACGCACTACCCTGACATCTACACCAGGGAAGAGCTAGCACTGAAGATCGACCTCACCGAGGCG
AGA
GTCCAGGTGTGGTTCCAGAACCGCCGGGCTAAGTTTCGCAAGCAGGAGCGCGCAGCCGCCGCTGCTG
CC
GCCGCCGCCAAAAACGGCTCCTCCGGGAAGAAGTCTGACTCCTCCCGGGACGACGAGAGCAAAGAGGC
C
AAGAGCACTGATCCCGACAGCACTGGGGGCCCGGGACCCAACCCCAACCCGACCCCCAGCTGTGGGGCA
AAT
GGCGGCGGTGGCGGAGGGCCCAGCCCAGCCGGAGCTCCGGGGGCGGCGGGCCCGGGGGGCCCGGGAG
GC
GAACCCGGCAAGGGCGGTGCGGCTGCGGCTGCTGCTGCAGCTGCAGCGGCTGCAGCGGCGGCTGCGGC
T
GCGGCGGCGGGAGGCCTGGCTGCGGCCGGAGGCCCCGGACAAGGCTGGGCTCCTGGCCCGGGCCCCATC
ACC
TCCATCCCAGATTCTCTTGGGGGGCCCTTCGCCAGCGTCTTATCTTCGCTCCAAAGACCCAACGGTG
CC
AAAGCCGCCTTAGTGAAGAGCAGTATGTTCTGA


Translation (314 aa):
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL
R
DHQSSPYAA
VPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEA
R
VQ
VWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGA
N
GGGGGGPSPAGAPGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPI
T
SIPDSLGGPFASVLSSLQRPNGAKAALVKSSMF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser