NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19307.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19307.1 Public Mus musculus 5 16 104 75 CCDS HistoryNCBI Gene:79464Re-query CCDS DB by CCDS ID:19307.1Re-query CCDS DB by GeneID:79464See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19307.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031101 ENSMUSP00000031101 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031101Link to Ensembl Protein Viewer:ENSMUSP00000031101Re-query CCDS DB by Nucleotide ID:ENSMUST00000031101Re-query CCDS DB by Protein ID:ENSMUSP00000031101
Original member Current member EBI,WTSI OTTMUST00000070247 OTTMUSP00000035767 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070247Link to Vega Protein Viewer:OTTMUSP00000035767Re-query CCDS DB by Nucleotide ID:OTTMUST00000070247Re-query CCDS DB by Protein ID:OTTMUSP00000035767
Original member Current member NCBI NM_024471.4 NP_077791.1 Accepted alive Link to Nucleotide Sequence:NM_024471.4Link to Protein Sequence:NP_077791.1Re-query CCDS DB by Nucleotide ID:NM_024471Re-query CCDS DB by Protein ID:NP_077791Link to BLink:NP_077791.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077791.1 373 Q99M04 373 100% 0 0

Chromosomal Locations for CCDS 19307.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 65391629 65391673 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65392220 65392389 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65393941 65394034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65395365 65395445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65397603 65397759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65397831 65397888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65399847 65399975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65402611 65402756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65404168 65404238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65405330 65405441 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 65408735 65408793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1122 nt):
ATGGCTCTACGCTGCTGGGATACAGCTCGCAGCCTGGGGTCCCGGATATTTGGAAGATATGCGTTCACGG
TT
AGAGCATTAAGTTCTTTGCCAGATAAGAAAAAGGAATTTTTGCATAATGGACCAGACCTTCAAGATTT
T
GTATCTGGTGATCTTGCAGACAAGAGTACATGGGATGAATATAAAGGAAACTTAAAGCGCCAGAAAGGA
GAA
AGGCTAAGACTACCTCCATGGCTAAAGACAAAGATACCCATGGGTAAAAACTACAATAAACTGAAAA
AT
ACATTGCGGAATTTAAGTCTCCACACAGTGTGTGAGGAAGCCCGGTGCCCCAACATTGGAGAGTGTTG
G
GGAGGTGGGGAATATGCCACAGCCACAGCCACGATCATGTTGATGGGGGACACATGCACAAGAGGTTGC
AGA
TTTTGTTCCGTTAAGACCGCAAGAAATCCCCCTCCATTGGATGCCAATGAGCCCGACAATACGGCCA
AA
GCAATTGCAGAGTGGGGTCTGGATTATGTTGTCCTGACGTCGGTGGATCGAGATGATGTGGCCGACGG
G
GGAGCTGAGCACATCGCCAAGACCGTGTCATGCTTGAAGGAAAGGAATCCAAAAATCCTCGTGGAATGC
CTC
ACCCCAGACTTCCGAGGTGATCTGAGAGCAGTGGAGAAGGTGGCTCTGTCTGGATTAGATGTGTATG
CA
CACAATGTGGAGACTGTCCCCGAGTTACAGAGGAAAGTTCGTGATCCCCGGGCCAATTTTGACCAGTC
T
CTTCGTGTACTGAGACATGCCAAGGAGGTCCAGCCTGATGTTGTTTCCAAAACATCGATAATGCTGGGC
CTT
GGTGAGACAGACGAGCAAGTCTATGCCACACTGAAAGCTCTCCGTGCGGCCGACGTGGACTGTTTAA
CT
CTAGGGCAGTACATGCAGCCAACGAAGCGCCACCTTAAGGTTGAAGAATATGTTACTCCTGAGAAGTT
C
AAATACTGGGAAAAAGTAGGGAATGAACTTGGATTTCTCTATACGGCAAGTGGTCCTTTGGTGCGATCT
TCA
TATAAAGCAGGTGAATTTTTCCTGAAAAATCTAGTGGCTAGAAGAAAAACAAAAGCTTCTAAAGTGT
AG


Translation (373 aa):
MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQDFVSGDLADKSTWDEYKGNLKRQKG
E
RLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGC
R
FCSVKTARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVDRD
DVADGGAEHIAKTVSCLKERNPKILVEC
L
TPDFRGDLRAVEKVALSGLDVYAHNVETVPELQ
RKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLG
L
GETDEQVYATLK
ALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRS
S
YKA
GEFFLKNLVARRKTKASKV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser