NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19292.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19292.1 Public Mus musculus 5 Rbpj 16 104 75 CCDS HistoryNCBI Gene:19664Re-query CCDS DB by CCDS ID:19292.1Re-query CCDS DB by GeneID:19664

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19292.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000037618 ENSMUSP00000040694 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037618Link to Ensembl Protein Viewer:ENSMUSP00000040694Re-query CCDS DB by Nucleotide ID:ENSMUST00000037618Re-query CCDS DB by Protein ID:ENSMUSP00000040694
Original member Current member NCBI NM_009035.5 NP_033061.3 Accepted alive Link to Nucleotide Sequence:NM_009035.5Link to Protein Sequence:NP_033061.3Re-query CCDS DB by Nucleotide ID:NM_009035Re-query CCDS DB by Protein ID:NP_033061Link to BLink:NP_033061.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033061.3 526 P31266-1 526 100% 0 0

Chromosomal Locations for CCDS 19292.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

Chromosome Start Stop Links
5 53590350 53590486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53627383 53627421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53635962 53636057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53642024 53642189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53645870 53646044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53649371 53649508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53649663 53649775 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53651340 53651480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53652607 53652762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53653082 53653185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 53653305 53653620 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1581 nt):
ATGCCCTCCGGTTTTCCTCAGTCTCCACGTACGTCCCCGAGGGCGCGTCCCAAAACCCGGATAACCGGAG
CG
CTCCCCATGGACTACTCGGAGGGCTTGTCCGCGGAGGAGCGGCCTGCGCATGCTCCATCGGCGGGGAA
G
TTTGGTGAGCGGCCTCCACCCAAACGACTCACTAGGGAAGCTATGCGAAATTATTTAAAAGAACGAGGG
GAT
CAAACAGTGCTCATTCTTCATGCAAAAGTTGCACAGAAGTCTTACGGAAATGAAAAACGATTTTTTT
GC
CCTCCTCCTTGTGTGTATCTTATGGGCAGTGGTTGGAAGAAAAAAAAAGAGCAAATGGAACGAGATGG
A
TGTTCTGAACAAGAGTCTCAACCCTGTGCGTTTATTGGAATAGGAAACAGTGACCAAGAAATGCAGCAG
CTG
AACTTGGAAGGGAAGAACTACTGTACAGCCAAAACATTGTACATATCTGATTCAGACAAGAGAAAAC
AT
TTCATGTTGTCTGTAAAGATGTTCTATGGCAACAGCGATGACATTGGTGTGTTCCTCAGCAAGCGGAT
A
AAGGTCATCTCCAAACCCTCCAAAAAGAAGCAGTCACTGAAGAATGCTGACTTGTGCATTGCTTCAGGA
ACG
AAGGTGGCACTGTTCAATCGCCTTCGGTCCCAGACAGTTAGTACCAGGTACCTGCATGTAGAAGGAG
GG
AATTTCCACGCCAGTTCACAACAGTGGGGAGCATTTTACATCCATCTCTTGGACGACGACGAGTCGGA
A
GGAGAGGAGTTCACAGTTAGAGATGGCTACATCCATTACGGGCAGACTGTCAAGCTTGTGTGCTCAGTG
ACT
GGCATGGCACTCCCAAGATTGATAATTAGGAAAGTTGATAAGCAGACGGCATTACTGGATGCAGACG
AC
CCTGTATCACAACTCCACAAATGTGCATTTTACCTTAAGGATACAGAAAGAATGTACTTGTGCCTTTC
T
CAAGAAAGAATAATCCAATTTCAGGCCACTCCATGTCCAAAAGAACAAAATAAGGAAATGATAAACGAT
GGA
GCTTCCTGGACAATCATTAGCACAGACAAGGCCGAGTACACGTTCTATGAGGGAATGGGCCCCGTCC
TT
GCCCCAGTCACCCCTGTGCCTGTCGTAGAAAGTCTTCAGTTGAATGGCGGCGGGGACGTAGCAATGCT
T
GAACTTACAGGACAAAACTTTACTCCAAATTTAAGAGTGTGGTTTGGGGATGTAGAAGCCGAAACAATG
TAC
AGATGTGGAGAGAGCATGCTCTGTGTGGTCCCAGACATTTCTGCATTCCGGGAAGGTTGGAGATGGG
TC
CGCCAGCCAGTCCAGGTTCCAGTGACTTTGGTCCGAAATGACGGGGTCATTTACTCCACCAGCCTTAC
C
TTCACCTACACACCAGAGCCAGGGCCGAGGCCACACTGCAGCGCTGCAGGAGCGATTCTCAGAGCCAAC
TCC
AGCCAAGTGCCCTCCAATGAGTCAAACACAAACAGCGAGGGGAATTACACAAATGCCAGCACAAATT
CT
ACCAGTGTCACATCGTCCACAGCAACCGTGGTGTCCTAA


Translation (526 aa):
MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSAGKFGERPPPKRLTREAMRNYLKERG
D
QTVLILHAKVAQKSYGNEK
RFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQ
L
NLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASG
T
KVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHL
LDDDESEGEEFTVRDGYIHYGQTVKLVCSV
T
GMALPRL
IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMIND
G
ASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQ
LNGGGDVAMLELTGQNFTPNLRVWFGDVEAETM
Y
RCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHCSAAGAILRAN
S
SQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser