NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19247.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19247.1 Public Mus musculus 5 Evc 16 104 75 CCDS HistoryNCBI Gene:59056Re-query CCDS DB by CCDS ID:19247.1Re-query CCDS DB by GeneID:59056

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19247.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031005 ENSMUSP00000031005 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031005Link to Ensembl Protein Viewer:ENSMUSP00000031005Re-query CCDS DB by Nucleotide ID:ENSMUST00000031005Re-query CCDS DB by Protein ID:ENSMUSP00000031005
Original member Current member EBI,WTSI OTTMUST00000061283 OTTMUSP00000030026 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000061283Link to Vega Protein Viewer:OTTMUSP00000030026Re-query CCDS DB by Nucleotide ID:OTTMUST00000061283Re-query CCDS DB by Protein ID:OTTMUSP00000030026
Original member Current member NCBI NM_021292.2 NP_067267.2 Accepted alive Link to Nucleotide Sequence:NM_021292.2Link to Protein Sequence:NP_067267.2Re-query CCDS DB by Nucleotide ID:NM_021292Re-query CCDS DB by Protein ID:NP_067267Link to BLink:NP_067267.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067267.2 1005 P57680-1 1005 100% 0 0

Chromosomal Locations for CCDS 19247.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 37300377 37300500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37300812 37300923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37301558 37301651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37303185 37303311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37307213 37307324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37309032 37309176 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37310161 37310367 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37311532 37311742 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37313429 37313538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37314359 37314571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37316325 37316423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37318163 37318311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37318889 37319105 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37320236 37320394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37322050 37322187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37323699 37323797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37324837 37324921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37326338 37326585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37328462 37328545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37332892 37333017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 37336635 37336793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3018 nt):
ATGACCTGCACTAAAGATGCGCGGCTGCAGCTGGGCCGGGAAGCCCTGCAGGCGGCGCCGACGCTGCTGG
TC
CCCGCGGTGCTACTGGGTGGCGTTCTCGGCCTAGGCCTTGGCTTGTGGCTTGGCTGTCGCGCGAGCCA
C
TTGCGCGCACGGCTCCAGAAAGATGACAGGAAACGTCTGCTCGGGAGTTCAGAGCCCCCTGCACAGAGC
CTA
CGGGACACTGGCTCTCAAGCCAAAGCCAGGAGGCGCCAGAGAGAAACCACTCGGGATGAAGACGCCC
CT
GAGGTGTGTGAGCCATCCTTGAGTGGCAACATCACGGCATTTGCACTGAAAGCCAGAGTTGTCTATCC
C
ATCAACCAGAAGTTCCGGCCTCTGGCCGACGGATCCTCCCACCCATCGCTGCATGAAAACCTGACACAG
GCA
GCGGCCATCCTGCCCCACCTGCCCCACCAGCCAGCAGAGGCCTCACCAGCCAGCAGCCTGGGCAGCC
TG
AGCCAGGCTGGCAAGGAGGACGGCAGCTCCTCCTCCAGCATGCGGTCAACCTACAGCGACGACCGGAT
C
CTCCAGTGTGCCTTTCTCCGGGTGGGCAGCTTCCCTGAGATCCTGGCCTGTGAGAGTGTGGACATTGAC
CTG
TGTGTCTGCAGCCTTCACCTGAAAGACCTGCTTCAGGTAGACACGGCGCTGAGGCAAGAGAAGCACC
TG
ATGTTCATTCAGATTCTTAAAGCATGCCTCCTGGATTTTTTTCCTAAAAAGAAGCCTGATGATGAATT
A
TGCCAGAAGGTTCTTTCCAAACAAGAGCATGATTTGGAGGAATTAGAAAAGGGACTCCAGGCCAGATTG
GCG
AACACAGAAATGTTAGGCACTGGCGACTCTGGCTACGTTTCCCTGGCAGATGTGGAGAGGAAGGAGA
GA
GAGCTCTCAGAGCAGCTCATAGACAACATGGGAGCTTTCTGGAAGCAGATGGAAAGCATCCAGCCCAC
T
CTCATGGACCAGTTTAAGTGTTCCAGCTCCAAAGCTCGGCAGTTCATGATGACTCTGACAGGAAGAATG
ATT
GTCGCTGAAGGACTGCTGCATGACTCTCAGGACCTGCATGTCCTGGACACCCTGGAGAGGACAATGG
GT
CGATCCCACTTGGCAAGAATGGTGGAGTTCCTGAGAACCCAGATCCAGGAGGAGACCAAGTGCAGACT
T
GCTGCCATCTCCCGTGGCCTGGAGTTGCTGACTGTCCAGGGGCAGCTGTCTGGGAGGCAAAAGGAGGAA
CTC
CTGACTCAGCAGCACAAGGCCTTCTGGGAGGAGGCAGAGCGTTTTGGCAGGGAATTCACGCAGCGGG
GC
AAAGATCTGGTCCAGGCGTCTCAGGCTCGCCAGGCAGAGGCAGCAGCAGAGCTCACACAGACCCAAGA
A
GAAGAACGGAGGAGTTTCCTGGCTGATTCCCAGCTGACCTCGGATCCTGGGGAATTCCTCAAGGCTTTT
CAT
GAGGTCCTGGAGAGGCAGCGGCTGACAAGGAGTGACCAAGAGGGAGACGAGGACACCCGAATCACTG
AG
GCCATGGCTGCGCTCTGCCAGGAGCTGTACTGTAGCACCATGGGAACCTTCCAAAAGTTTGTGGACTC
C
CTGTTCCTGAAGACCCTCCCAGAAGTGACCAGCCTCCCTGTGGCAGAATGTGAGACCCTGCGGCAGCAG
GTC
CAGGAGCAGGCAGCAAGGCAGCTGGGACAGGCAGACCGATTCCGCAGACGACAGTGGGGACTCCTAT
GT
GATCTATTGGAGCAGGACAAACGGGTGTGGCTGGAGGAGGGTACGCTGTCCACGGTGCTGCAGAGGCA
G
CTGCGGGATCACCACGAGAGCACCATCCACGGCGTCCTGAGCAGATTCAGTGGCCTTTCTGAAGAGTCC
TCA
CGAGGCATCCTGCAGGGCCACGAACTGCTGCTGTGCTCTGCTCTGCGCAGACTGGCCCTCCGAGGCA
CC
ACCATCACTGCCCTGGCTCAGATGAGGCTGTCTGGGAAGAAGAGGCTCCTGCAGGAGCTACATGAGCA
G
CTGGCATTAGAGCAGGGTGTGTCCCCATGCCTGGAGGAGCATCAATGGCAGCTGCTTAGAGCCCTGGAG
GCG
CGGATCCAGGAGGAGGCAGCCAGGTTGGAGGATGAGGCACAGCAGACAGGTCTGCGGCTCCAGCAGC
AG
CTGCTGGCGGAGGCACAGGAGGCAGGGCGGCTGCTACAGCTGCACATGGAGCGGGTCATTGGGCAGGC
G
CTGCTGGTACATGCTAGGAATGTTGCCAGCAAAGGCCGGACCAGGGAGAAGGAAGACTTCAAGAGGACG
CTG
GTAGAGACGGTGGTGGAGAGTGTGTATGTGACCAGCACTAGTGTCAACCGCCTCGTGCAGGCGCATT
AC
CAGGCCGTCGGGAAGCTCCTGCAGGCTCATGAGGAACAATTGCTGCAGCGCCTAAAGACCCTGCAGGG
A
GAGAGAATCAATGCTTACAAGCTGTGGAAGAAGCAAGAATTCAGTGACCCGTCGTTGGAGAGTCAAACA
GCG
GATGGTACCCATGGAGCTTCCCAGGGGGTACAGCAGAGGATGCTTTCGCAGCAGAAGAGGCTCCTGG
AC
CAGTTCACGAAGCATCAGCAAGGCCGCCTGAACTCTCAGAGGCAGAAGGCACAAGAGCTGGACCAGCT
G
CAAGCCCAGCTTGAGACCCAGCTGCAGGAAGCTGAGCAGACCCTTATCTCAGAGCTATCGACATTGGCC
CGA
GTACCCCTTCCTGAGAACAAGCCATTCTCCAACAAGCGAGGACTTCCAGAAAAGCCAGTAAGAACCA
AA
AGGAAGAAACCCCCACCTCGGGAGAGAGAGGACCTGGGGACACCAAACGATGACCACCTTGCCTTGGC
C
GACCACACCACAGGACCACTCAGTACAACCTACTCAGCATCGCCTCCCATCCGTGTCCACAGCGGCGGA
AGG
CTGGATCAGCAGGACAGCGAAGCTGGCGATGGAGAAAGCACAAGCAAGATACTGCAGAAAGGAAGCA
AT
CTGTAG


Translation (1005 aa):
MTCTKDARLQLGREALQAAPTLLVPAVLLGGVLGLGLGLWLGCRASHLRARLQKDDRKRLLGSSEPPAQS
L
RDTGSQAKARRRQRETTRDEDAPE
VCEPSLSGNITAFALKARVVYPINQKFRPLADGSSHPSLHENLTQ
A
AAILPHLPHQPAEASPASSLGSLSQAGKEDGSSSSSMRSTYSDDRILQCAFLRVGSFPEILACE
SVDID
L
CVCSLHLKDLLQVDTALRQEKHL
MFIQILKACLLDFFPKKKPDDELCQKVLSKQEHDLEELEKGLQARL
A
NTEMLGTGDSGYVSLADVERKERELSEQLIDN
MGAFWKQMESIQPTLMDQFKCSSSKARQFMMTLTGRM
I
VAEGLLHDSQDLHVL
DTLERTMGRSHLARMVEFLRTQIQEETKCRLAAISRGLELLTVQGQLSGRQKEE
L
LTQQHKAFWEEAERFGR
EFTQRGKDLVQASQARQAEAAAELTQTQEEERRSFLADSQLTSDPGEFLKAF
H
EVLERQRLTRSDQEGDEDTRITEAMAALCQ
ELYCSTMGTFQKFVDSLFLKTLPEVTSLPVAECETLRQQ
V
QEQAARQLGQADRFRRRQWGLLCDLLEQDKR
VWLEEGTLSTVLQRQLRDHHESTIHGVLSRFSGLSEES
S
RGILQGHELLLCSALRRLALRGTTITALAQMRLSGKKRLLQELHEQLALEQGVSPCLEEHQWQLLRAL
E
A
RIQEEAARLEDEAQQTGLRLQQQLLAEAQEAGRLLQLHMERVIGQALLVHARNVASKGRTREKEDFK
RT
L
VETVVESVYVTSTSVNRLVQAHYQAVGKLLQAHEEQLLQRLKTLQ
GERINAYKLWKKQEFSDPSLESQT
A
DGTHGASQGVQQ
RMLSQQKRLLDQFTKHQQGRLNSQRQKAQELDQLQAQLETQLQEAEQTLISELSTLA
R
VPLPENKPFSNKRGLP
EKPVRTKRKKPPPREREDLGTPNDDHLALADHTTGPLSTTYSASPPIRVHSGG
R
LDQQDSEAGDGESTSKILQKGSNL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser