NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19179.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19179.1 Public Mus musculus 5 Ppm1g 16 104 75 CCDS HistoryNCBI Gene:14208Re-query CCDS DB by CCDS ID:19179.1Re-query CCDS DB by GeneID:14208

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19179.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031032 ENSMUSP00000031032 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031032Link to Ensembl Protein Viewer:ENSMUSP00000031032Re-query CCDS DB by Nucleotide ID:ENSMUST00000031032Re-query CCDS DB by Protein ID:ENSMUSP00000031032
Original member Current member NCBI NM_008014.3 NP_032040.1 Accepted alive Link to Nucleotide Sequence:NM_008014.3Link to Protein Sequence:NP_032040.1Re-query CCDS DB by Nucleotide ID:NM_008014Re-query CCDS DB by Protein ID:NP_032040Link to BLink:NP_032040.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032040.1 542 Q61074 542 100% 0 0

Chromosomal Locations for CCDS 19179.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

Chromosome Start Stop Links
5 31203081 31203284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31203572 31203674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31204030 31204159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31204453 31204687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31204998 31205129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31206038 31206453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31207563 31207695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31208013 31208098 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31208387 31208456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 31220303 31220422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1629 nt):
ATGGGTGCCTACCTCTCTCAGCCCAACACGGTGAAGTGCTCCGGGGACGGGGTTGGCGCCCCGCGGCTCC
CG
CTGCCCTACGGCTTCTCCGCCATGCAAGGCTGGCGCGTCTCCATGGAGGATGCTCACAACTGTATTCC
T
GAGCTGGACAATGAGACAGCCATGTTTTCTGTCTACGATGGACATGGAGGGGAAGAGGTTGCCTTGTAC
TGT
GCCAAATATCTTCCTGATATTATCAAAGATCAGAAGGCCTACAAGGAAGGCAAGCTTCAGAAGGCTT
TA
CAAGATGCCTTCTTGGCTATTGATGCCAAGCTGACCACAGAGGAAGTCATTAAGGAACTGGCCCAGAT
T
GCAGGGAGACCCACTGAAGATGAGGATGATAAAGACAAAGTAGCAGATGAGGATGATGTGGACAATGAG
GAG
GCTGCATTGTTGCATGAAGAGGCTACCATGACTATTGAAGAGCTGCTGACGCGATATGGGCAGAACT
GT
CAGAAGGTCCCTCCCCACACCAAATCTGGAATTGGGACAGGCGATGAACCAGGGCCCCAGGGCCTCAA
T
GGGGAGGCTGGACCTGAGGACCCATCTAGGGAAACTCCTTCCCAGGAAAATGGCCCCACAGCCAAAGGC
CAC
ACAGGCTTTTCCTCCAACTCGGAACATGGGACTGAGGCAGGCCAAATTAGTGAGCCCGGTACTGCTA
CC
GGTGAGGCTGGACCTTCCTGCTCTTCAGCCTCTGACAAGCTGCCTCGAGTTGCTAAGTCCAAGTTCTT
T
GAGGACAGTGAAGATGAATCAGATGAGGTGGAGGAAGAGGAGGATGACAGTGAGGAATGTAGTGAGGAC
GAG
GACGGCTACAGCAGTGAGGAGGCAGAGAACGAGGAAGACGAGGATGACACGGAGGAGGCTGAAGAGG
AT
GATGATGAAGAGATGATGGTCCCTGGAATGGAAGGCAAAGAAGAGCCTGGTTCTGACAGTGGCACAAC
A
GCGGTGGTGGCTCTGATCAGAGGGAAGCAGTTGATTGTGGCCAATGCAGGAGACTCTCGCTGTGTGGTG
TCC
GAGGCTGGCAAAGCTTTAGATATGTCCTATGACCACAAACCAGAGGATGAAGTGGAGCTGGCACGCA
TC
AAGAATGCTGGTGGCAAGGTCACCATGGATGGACGAGTCAATGGAGGCCTCAACCTCTCCAGGGCCAT
T
GGAGACCACTTCTACAAGAGAAACAAAAACTTGCCACCCCAGGAACAGATGATTTCTGCCCTTCCTGAC
ATC
AAGGTGCTGACTCTCACTGATGACCATGAATTCATGGTCATTGCTTGTGACGGCATCTGGAATGTGA
TG
AGCAGCCAGGAGGTTGTAGACTTTATTCAATCAAAGATCAGTCAACGTGATGAAAACGGGGAGCTTCG
G
TTATTGTCATCCATTGTGGAAGAGCTGCTGGATCAGTGCCTGGCGCCAGACACTTCTGGGGATGGTACA
GGG
TGTGACAACATGACGTGCATCATCATTTGCTTCAAGCCCCGAAACACAGTAGAGCTTCAGGCAGAGA
GT
GGCAAGAGGAAACTGGAGGAGGCACTGTCCACGGAGGGGGCTGAAGACACCGGCAACAGTGACAAAAA
G
AAGGCCAAGAGGGACTAG


Translation (542 aa):
MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDNETAMFSVYDGHGGEEVALY
C
AKYLPDIIKDQKAYKEGKLQK
ALQDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDDKDKVADEDDVDNE
E
AALLHEEATMTIEELLTRYGQNCQKVPPHTKSGIGTGDEPGPQGLNGEAGPEDPSRETPSQENGPTAKG
H
TGFSSNSEHGTEAGQISEPGTATGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEVEEEEDDSE
ECSED
E
DGYSSEEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEE
PGSDSGTTAVVALIRGKQLIVANAGDSRCVV
S
EAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAI
GDHFYKRNKNLPPQEQMISALPD
I
KVLTLTDDHEFMVIACDGI
WNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGT
G
CDNMTCIIICFKPRNTVELQAESGKRKLEEALSTEGAEDTGNSDKKKAKRD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser