NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18927.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18927.1 Public Mus musculus 4 Nppa 16 104 75 CCDS HistoryNCBI Gene:230899Re-query CCDS DB by CCDS ID:18927.1Re-query CCDS DB by GeneID:230899

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18927.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000103230 ENSMUSP00000099520 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000103230Link to Ensembl Protein Viewer:ENSMUSP00000099520Re-query CCDS DB by Nucleotide ID:ENSMUST00000103230Re-query CCDS DB by Protein ID:ENSMUSP00000099520
Original member Current member EBI,WTSI OTTMUST00000023685 OTTMUSP00000010827 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000023685Link to Vega Protein Viewer:OTTMUSP00000010827Re-query CCDS DB by Nucleotide ID:OTTMUST00000023685Re-query CCDS DB by Protein ID:OTTMUSP00000010827
Original member Current member NCBI NM_008725.2 NP_032751.1 Accepted alive Link to Nucleotide Sequence:NM_008725.2Link to Protein Sequence:NP_032751.1Re-query CCDS DB by Nucleotide ID:NM_008725Re-query CCDS DB by Protein ID:NP_032751Link to BLink:NP_032751.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032751.1 152 P05125 152 100% 0 0

Chromosomal Locations for CCDS 18927.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 148000835 148000954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148001058 148001384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148001775 148001786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (459 nt):
ATGGGCTCCTTCTCCATCACCCTGGGCTTCTTCCTCGTCTTGGCCTTTTGGCTTCCAGGCCATATTGGAG
CA
AATCCTGTGTACAGTGCGGTGTCCAACACAGATCTGATGGATTTCAAGAACCTGCTAGACCACCTGGA
G
GAGAAGATGCCGGTAGAAGATGAGGTCATGCCCCCGCAGGCCCTGAGTGAGCAGACTGAGGAAGCAGGG
GCC
GCACTTAGCTCCCTCCCCGAGGTGCCTCCCTGGACTGGGGAGGTCAACCCACCTCTGAGAGACGGCA
GT
GCTCTAGGGCGCAGCCCCTGGGACCCCTCCGATAGATCTGCCCTCTTGAAAAGCAAACTGAGGGCTCT
G
CTCGCTGGCCCTCGGAGCCTACGAAGATCCAGCTGCTTCGGGGGTAGGATTGACAGGATTGGAGCCCAG
AGT
GGACTAGGCTGCAACAGCTTCCGGTACCGAAGATAA


Translation (152 aa):
MGSFSITLGFFLVLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQALSEQTEEAG
A
ALSSLPEVPPWTGEVNPPLRDGSALGRSPWDPSDRSALLKSKLRALLAGPRSLRRSSCFGGRIDRIGAQ
S
GLGCNSFR
YRR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser