NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18825.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18825.1 Public Mus musculus 4 Pink1 16 104 75 CCDS HistoryNCBI Gene:68943Re-query CCDS DB by CCDS ID:18825.1Re-query CCDS DB by GeneID:68943See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18825.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030536 ENSMUSP00000030536 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030536Link to Ensembl Protein Viewer:ENSMUSP00000030536Re-query CCDS DB by Nucleotide ID:ENSMUST00000030536Re-query CCDS DB by Protein ID:ENSMUSP00000030536
Original member Current member EBI,WTSI OTTMUST00000023184 OTTMUSP00000010580 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000023184Link to Vega Protein Viewer:OTTMUSP00000010580Re-query CCDS DB by Nucleotide ID:OTTMUST00000023184Re-query CCDS DB by Protein ID:OTTMUSP00000010580
Original member Current member NCBI NM_026880.2 NP_081156.2 Accepted alive Link to Nucleotide Sequence:NM_026880.2Link to Protein Sequence:NP_081156.2Re-query CCDS DB by Nucleotide ID:NM_026880Re-query CCDS DB by Protein ID:NP_081156Link to BLink:NP_081156.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081156.2 580 Q99MQ3 580 100% 0 0

Chromosomal Locations for CCDS 18825.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 138313956 138314213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138315497 138315733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138316004 138316131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138317305 138317468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138317896 138318078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138319989 138320089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138320738 138321022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 138325833 138326219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1743 nt):
ATGGCGGTGCGACAGGCACTGGGCCGAGGCCTGCAGCTGGGTCGGGCGCTGCTGCTGCGCTTCGCGCCCA
AG
CCCGGCCCGCTGTTCGGCTGGGGGAAGCCCGGCCCCGCGGCGGCCTGGGGCCGCGGAGAGCGCCCAGG
C
CAGGTCGTAAGCCCCGGAGCACAGCCTCGGCCGGTCGGGCTCCCCCTCCCGGACCGCTACCGCTTCTTC
CGC
CAGTCGGTAGCTGGGCTGGCGGCGCGGATCCAGAGGCAGTTCATGGTGCGGGCCCGGGGCGGCGCAG
GC
CCTTGCGGCCGAGCGGTCTTCCTGGCCTTCGGGCTGGGGCTGGGGCTGATCGAGGAGAAGCAGGCGGA
A
GGCCGGAGGGCCGCCTCGGCCTGTCAGGAGATCCAGGCAATTTTTACACAGAAAACCAAGCGCGTGTCT
GAC
CCACTGGACACTCGATGCTGGCAGGGCTTCCGTCTGGAGGATTATCTGATAGGGCAAGCCATTGGCA
AG
GGTTGCAATGCCGCTGTGTATGAAGCCACCATGCCCACGCTGCCCCAGCACCTGGAAAAGGCCAAACA
C
CTTGGCCTTATAGGAAAGGGCCCGGATGTCGTCCTGAAGGGAGCAGACGGGGAGCAGGCTCCAGGGACT
CCC
ACCTTTCCCTTTGCCATCAAGATGATGTGGAATATCTCGGCAGGTTCCTCCAGCGAAGCCATCTTAA
GC
AAAATGAGCCAGGAGCTGGTCCCGGCAAGCCGCGTGGCTTTGGCTGGAGAGTATGGAGCAGTTACTTA
C
AGAAGATCCAGAGATGGTCCCAAGCAGCTTGCCCCACACCCTAACATCATCCGGGTTTTCCGCGCCTTC
ACC
TCATCTGTGCCCCTCCTGCCGGGGGCCCTGGCTGACTATCCTGATATGCTGCCCCCACACTACTACC
CA
GAAGGCCTGGGCCACGGTCGCACACTGTTCCTCGTTATGAAGAACTACCCCTGTACCCTGCGCCAGTA
C
CTTGAGGAGCAGACTCCCAGTTCTCGCCTGGCTACCATGATGACCTTGCAGTTGCTGGAGGGCGTGGAC
CAT
CTGGTTCAGCAGGGCATTGCCCATCGGGATCTCAAGTCCGACAACATCCTTGTGGAGTGGGACTCAG
AT
GGCTGTCCCTGGCTAGTGATCTCAGACTTTGGCTGCTGCCTGGCTGACCAGCATGTTGGCCTGCGGCT
G
CCTTTCAACAGCTCCAGTGTAGAGCGTGGTGGCAATGGCTCCCTGATGGCCCCTGAGGTGTCCACAGCC
CAT
TCTGGCCCCAGTGCGGTAATTGACTACAGCAAAGCCGATACCTGGGCTGTGGGGGCCATCGCCTATG
AA
ATCTTTGGGCTTGCCAATCCCTTCTATGGCCAAGGCAGTGCCCACCTCGAGAGCCGCAGCTACCAGGA
A
GCTCAGCTGCCTGAGATGCCTGAGTCGGTGCCTCCAGAGGCAAGACGGCTGGTGAGGTCACTGCTCCAG
CGA
GAGGCCAGCAAGAGACCGTCTGCACGCTTAGCTGCAAATGTGCTGCACTTAAGCCTCTGGGGCGAGC
AT
CTTCTAGCCCTGAAGAACCTGAAATTGGACAAGATGATCGCCTGGCTCTTGCAGCAGTCAGCAGCCAC
T
CTGCTGGCTGACAGGCTGAGAGAGAAGAGCTGCGTGGAGACAAAGCTGCAGATGCTGTTTCTGGCTAAC
CTG
GAGTGTGAGGCTCTCTGCCAGGCAGCCCTCCTCCTCTCTTCCTGGAGGGCAGCCCCATGA


Translation (580 aa):
MAVRQALGRGLQLGRALLLRFAPKPGPLFGWGKPGPAAAWGRGERPGQVVSPGAQPRPVGLPLPDRYRFF
R
QSVAGLAARIQRQFMVRARGGAGPCGRAVFLAFGLGLGLIEEKQAEGRRAASACQEIQ
AIFTQKTKRVS
D
PLDTRCWQGFRLEDYLIGQAIGKGCNAAVYEATMPTLPQHLEKAKHLGLIGKGPDVVLKGADGEQAPGT
P
TFPFAIKMMWNIS
AGSSSEAILSKMSQELVPASRVALAGEYGAVTYRRSRDGPKQLAPHPNIIRVFRAF
T
SSVPLLPGALADYPDMLPPHYYPEGLGHGRTLFLVMK
NYPCTLRQYLEEQTPSSRLATMMTLQLLEGVD
H
LVQQGIAHRDLKSDNILVEWDS
DGCPWLVISDFGCCLADQHVGLRLPFNSSSVERGGNGSLMAPEVSTA
H
SGPSAVIDYSKADTWAVGAIAYEIFGLANPFYGQGSAHLESRSYQEAQLPEMPESVPPEARRLVRSLLQ
R
EASK
RPSARLAANVLHLSLWGEHLLALKNLKLDKMIAWLLQQSAATLLADRLREKSCVETKLQMLFLAN
L
ECEALCQAALLLSSWRAAP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser