NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18816.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18816.1 Public Mus musculus 4 Cdc42 19 105 81 CCDS HistoryNCBI Gene:12540Re-query CCDS DB by CCDS ID:18816.1Re-query CCDS DB by GeneID:12540See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18816.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000051477 ENSMUSP00000054634 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051477Link to Ensembl Protein Viewer:ENSMUSP00000054634Re-query CCDS DB by Nucleotide ID:ENSMUST00000051477Re-query CCDS DB by Protein ID:ENSMUSP00000054634
Original member Current member EBI,WTSI OTTMUST00000022761 OTTMUSP00000010388 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000022761Link to Vega Protein Viewer:OTTMUSP00000010388Re-query CCDS DB by Nucleotide ID:OTTMUST00000022761Re-query CCDS DB by Protein ID:OTTMUSP00000010388
Original member Current member NCBI NM_009861.3 NP_033991.1 Accepted alive Link to Nucleotide Sequence:NM_009861.3Link to Protein Sequence:NP_033991.1Re-query CCDS DB by Nucleotide ID:NM_009861Re-query CCDS DB by Protein ID:NP_033991Link to BLink:NP_033991.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033991.1 191 P60766 191 100% 0 0

Chromosomal Locations for CCDS 18816.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 137321103 137321192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 137328713 137328910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 137329015 137329124 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 137332407 137332479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 137335975 137336079 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (576 nt):
ATGCAGACAATTAAGTGTGTTGTTGTTGGTGATGGTGCTGTTGGTAAAACATGTCTCCTGATATCCTACA
CA
ACAAACAAATTCCCATCGGAATATGTACCAACTGTTTTTGACAACTATGCAGTCACAGTTATGATTGG
T
GGAGAGCCATACACTCTTGGACTTTTTGATACTGCAGGGCAAGAGGATTATGACAGACTACGACCGCTA
AGT
TATCCACAGACAGATGTTTTTCTAGTATGTTTCTCAGTGGTCTCTCCATCCTCATTTGAAAATGTGA
AA
GAAAAGTGGGTGCCTGAGATAACTCACCACTGTCCAAAGACTCCTTTCTTGCTTGTTGGGACCCAAAT
T
GATCTCAGAGATGACCCCTCTACTATTGAGAAACTTGCCAAGAACAAACAGAAGCCTATTACTCCAGAG
ACT
GCTGAAAAGCTGGCGCGGGATCTGAAGGCTGTCAAGTATGTGGAGTGCTCTGCCCTCACACAGAAAG
GC
CTAAAGAATGTGTTTGATGAAGCAATATTGGCTGCCCTGGAGCCTCCAGAACCGAAGAAGAGCCGCAG
G
TGTGTGCTGCTATGA


Translation (191 aa):
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL
S
YPQTDVFLVCFSVVSPSSFENVKEK
WVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE
T
AEKLARDLKAVKYVECSALTQ
KGLKNVFDEAILAALEPPEPKKSRRCVLL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser