NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18257.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18257.1 Public Mus musculus 4 Whrn 16 104 75 CCDS HistoryNCBI Gene:73750Re-query CCDS DB by CCDS ID:18257.1Re-query CCDS DB by GeneID:73750

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18257.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000063650 ENSMUSP00000069664 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063650Link to Ensembl Protein Viewer:ENSMUSP00000069664Re-query CCDS DB by Nucleotide ID:ENSMUST00000063650Re-query CCDS DB by Protein ID:ENSMUSP00000069664
Original member Current member EBI,WTSI OTTMUST00000000708 OTTMUSP00000000316 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000000708Link to Vega Protein Viewer:OTTMUSP00000000316Re-query CCDS DB by Nucleotide ID:OTTMUST00000000708Re-query CCDS DB by Protein ID:OTTMUSP00000000316
Original member Current member NCBI NM_028640.2 NP_082916.1 Accepted alive Link to Nucleotide Sequence:NM_028640.2Link to Protein Sequence:NP_082916.1Re-query CCDS DB by Nucleotide ID:NM_028640Re-query CCDS DB by Protein ID:NP_082916Link to BLink:NP_082916.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082916.1 907 Q80VW5-3 907 100% 0 0

Chromosomal Locations for CCDS 18257.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 63415484 63415666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63416002 63416124 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63416412 63416593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63418088 63418622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63419422 63419493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63431850 63432059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63432665 63432877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63434110 63434146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63435360 63435562 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63461282 63461407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63472650 63472868 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 63494613 63495233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2724 nt):
ATGAACGCACAGCTGGACGGCCTGTCGGTGAGCTCGTCCTCCACCGGCTCGCTGGGCTCGGCGGCGGCGG
CG
GCGGGCGGCGGCGGGGGCGCGGGGTTGCGGCTGCTGTCTGCCAACGTGCGCCAGCTGCACCAAGCGCT
C
ACGGCGCTGCTGAGCGAGCCCGAGCGGGAGCAGTTCACTCACTGCCTCAACGCGTACCACGCGCGCCGC
AAC
GTCTTCGACCTGGTGCGCACCCTGCGCGTCCTGCTGGACAGCCCGGTCAAGCGGCGTCTGCTGCCCA
TG
CTGCGTCTGGTCATCCCGCGCTCCGACCAGCTGCTCTTCGACCAGTACACGGCCGAGGGCCTCTACCT
G
CCAGCCACCACCCCCTACAGGCAGCCCGCCTGGGCCGCTCCCGACGGCGCGGGGCCCGGGGAGGTGCGA
CTC
GTGAGCCTGCGGCGCGCCAAGGCCCACGAGGGCTTGGGCTTCAGCATCCGCGGGGGCTCGGAACACG
GC
GTGGGCATCTACGTGTCTCTAGTGGAGCCGGGCTCCCTGGCAGAGAAGGAAGGGTTGCGGGTCGGGGA
C
CAGATTCTGCGCGTCAACGATAAATCTCTAGCCCGGGTGACCCACGCGGAGGCTGTCAAGGCTCTCAAA
GGC
TCCAAGAAGCTGGTGCTGTCTGTATACTCAGCTGGGCGTATCCCAGGGGGCTATGTGACCAACCACA
TC
TACACCTGGGTGGACCCACAGGGTCGAAGCACATCCCCTCCCTCCAGCCTGCCCCAGCCCCATGGCAG
C
ACCCTGAGACAGCGTGAAGATGACCGAAGGAGTACCCTCCACCTCCTGCAGAGTGGAGATGAGAAAAAG
GTG
AACCTGGTGTTGGGGGACGGCCGGTCCTTGGGCCTCACGATCCGAGGTGGAGCAGAGTACGGCCTTG
GC
ATTTACATCACTGGTGTGGACCCAGGCTCTGAAGCAGAGAGCAGCGGCCTCAAGGTTGGAGACCAGAT
T
CTGGAGGTGAATGGGCGGAGCTTTCTCAACATCCTGCATGATGAGGCAGTGAAGCTGCTCAAGTCATCC
CGG
CACCTCATCCTGACGGTGAAGGACGTCGGAAGGCTGCCCCACGCACGTACCACCGTGGACCAGACCA
AG
TGGATCGCCAGTTCCCGGATCGGGGAAAGCGTCGCCAACTCAGCAGGGTTTCCAGGGGACCACACAGA
A
GAAGGGACAAGCAAGCCAGGATTTTACAAGGGCCCAGCCGGCTCCCAGGTGACCCTGAGCAGCCTGGGG
AAT
CAGACTCGTGCACTGCTGGACGACCAAGCCAGGCACCTGCTGACAGAGCAGGAGCGCGCCACCATGA
TG
TACTACCTGGCCCAGTACCGTGGTGGCACCATCTCTGTGGAGGCCATGGTCATGGCACTGTTTGAGTT
G
CTCAACACACACGCCAAGTTCTCACTCCTGTCTGAGGTGAGAAGCATCATCTCACCCCAAGACCTGGAC
CGC
TTTGACCACCTGGTGCTGAGGCGCGAGATCGAGTCTATGAAGGCGAGGCAGCCCCCCGGCCCCGGGG
TT
GGAGACACGTATTCCATGGTTTCCTACAGCGACACAGGCTCATCCACAGGCAGCCACGGCACCTCTAC
A
ACCGTCAGCTCGGCCAGGAATACATTAGACCTGGAAGGAACCGGTGAGACCACCCAGGGCAGCACCAAC
GCT
CTCCCGGATGTGTCTGTGGATGATGTCAAATCCCCCTCAGAAGATCTGCCTGGTATCAAGCCACCTC
CT
CCCCCACCACCCCTGGCTCAAGGTCATGACCGCTTGCTTGGCCAGCCACGGAAGCCAGGGAGGGAGGA
C
CCCGCACCTCTGTCTTCTGCTGCCCACTCAGGCATTGTCTTCTCAGCACCACGGAACCGCAGCCCGCCG
CCA
GGGACTGCTCCCACTCCGGGACCTTCCTCAGCACAGGACTCTCCCTCCTCCCCCATTTATGCCTCCA
TC
TCCCATGCCAACCCCAGTTCCAGAAAGCCGCTGGACACCCACCTGGCCCTGGTTAACCAGCACCCCAT
C
GGCCCCTTCCCTCGAGTCCAGTCCCCACCTCACCTGAAGAGCCCTCCTGCAGAGACCCCAGGAGCTGGG
GCC
TGCCTTCCACCACCATCACCCTCTGAACACCCTGACGCCGTGGGTGCAAACCAGCACTTTGTTCTGG
TG
GAGGTGCACCGTCCGGACAGTGAGCCTGATGTGAATGAAGTGCGGGCTCTGCCCCAGACTCGCACAGC
C
TCCACACTCTCTCAGCTCTCAGACAGTGGGCAGACCCTGAGCGAGGACAGTGGCGTGGATGCCGGGGAG
ACG
GAGGCCAGCACCTCAGGCCGAGGCAGACAGACAGCATCCGCTAAGAACAAGAATGGCAAGGAGCAGC
CC
CGGACGGAGAGGACCGCGGAGGGTGCCAACAAACCTCCCGGCCTGCTGGAGCCAACGTCCACCCTGGT
C
CGTGTGAGGAAAAGTGCAGCCACACTGGGCATCGCCATTGAGGGCGGTGCCAACACACGCCAGCCTCTG
CCC
AGGATCGTCACAATTCAGCGAGGAGGTTCTGCCCATAACTGTGGACAGCTCAAGGTGGGCCACGTAA
TT
CTGGAAGTGAATGGGCAGACACTTCGGGGTAAGGAGCACAAGGAGGCCGCCCGAATCATCGCTGAGGC
C
TTCAAGACCAAGGAGAGAGACTACATCGACTTTCTGGTCACTGAGTTCAACGTGATGCTCTAG


Translation (907 aa):
MNAQLDGLSVSSSSTGSLGSAAAAAGGGGGAGLRLLSANVRQLHQALTALLSEPEREQFTHCLNAYHARR
N
VFDLVRTLRVLLDSPVKRRLLPMLRLVIPRSDQLLFDQYTAEGLYLPATTPYRQPAWAAPDGAGPGEVR
L
VSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVK
ALK
G
SKKLVLSVYSAGRIPGGYVTNHIYTWVDPQGRSTSPPSSLPQPHGSTLRQREDDRRSTLHLLQSGDEKK

V
NLVLGDGRSLGLTIRGGAEYGLGIYITGVDPGSEAESSGLK
VGDQILEVNGRSFLNILHDEAVKLLKSS
R
HLILTVKDVGRLPHARTTVDQTKWIASSRIGESVANSA
GFPGDHTEEGTSKPGFYKGPAGSQVTLSSLG
N
QTRALLDDQARHLLTEQERATMMYYLAQYRGGTISVEAMVMALFELLNTHAK
FSLLSEVRSIISPQDLD
R
FDHLVLRREIESMKARQPPGPGVGDTYSMVSYSDTGSSTGSHGTSTTVSSAR
NTLDLEGTGETTQGSTN
A
LPDVSV
DDVKSPSEDLPGIKPPPPPPPLAQGHDRLLGQPRKPGREDPAPLSSAAHSGIVFSAPRNRSPP
P
GTAPTPGPSSAQDSPSSPIYASISHANPSSRKPLDTHLALVNQHPIGPFPRVQSPPHLKSPPAETPGAG
A
CLPPPSPSEHPDAVGANQHFVLVEVHRPDSEPDVNEVRALPQTR
TASTLSQLSDSGQTLSEDSGVDAGE
T
EASTSGRGRQTASAKNKNGKEQPRTERTAEGANKP
PGLLEPTSTLVRVRKSAATLGIAIEGGANTRQPL
P
RIVTIQ
RGGSAHNCGQLKVGHVILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVML



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser