NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18243.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18243.1 Public Mus musculus 4 Alad 16 104 75 CCDS HistoryNCBI Gene:17025Re-query CCDS DB by CCDS ID:18243.1Re-query CCDS DB by GeneID:17025See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18243.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030090 ENSMUSP00000030090 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030090Link to Ensembl Protein Viewer:ENSMUSP00000030090Re-query CCDS DB by Nucleotide ID:ENSMUST00000030090Re-query CCDS DB by Protein ID:ENSMUSP00000030090
Original member Current member EBI,WTSI ENSMUST00000107444 ENSMUSP00000103068 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107444Link to Ensembl Protein Viewer:ENSMUSP00000103068Re-query CCDS DB by Nucleotide ID:ENSMUST00000107444Re-query CCDS DB by Protein ID:ENSMUSP00000103068
Original member Current member EBI,WTSI OTTMUST00000020466 OTTMUSP00000009376 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000020466Link to Vega Protein Viewer:OTTMUSP00000009376Re-query CCDS DB by Nucleotide ID:OTTMUST00000020466Re-query CCDS DB by Protein ID:OTTMUSP00000009376
Original member Current member EBI,WTSI OTTMUST00000020467 OTTMUSP00000009377 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000020467Link to Vega Protein Viewer:OTTMUSP00000009377Re-query CCDS DB by Nucleotide ID:OTTMUST00000020467Re-query CCDS DB by Protein ID:OTTMUSP00000009377
Original member Current member NCBI NM_001276446.1 NP_001263375.1 Accepted alive Link to Nucleotide Sequence:NM_001276446.1Link to Protein Sequence:NP_001263375.1Re-query CCDS DB by Nucleotide ID:NM_001276446Re-query CCDS DB by Protein ID:NP_001263375Link to BLink:NP_001263375.1
Original member Current member NCBI NM_008525.4 NP_032551.3 Accepted alive Link to Nucleotide Sequence:NM_008525.4Link to Protein Sequence:NP_032551.3Re-query CCDS DB by Nucleotide ID:NM_008525Re-query CCDS DB by Protein ID:NP_032551Link to BLink:NP_032551.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001263375.1 330 P10518 330 100% 0 0
NP_032551.3 330 P10518 330 100% 0 0

Chromosomal Locations for CCDS 18243.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 62509249 62509310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62510105 62510234 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62510515 62510601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62510694 62510781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62510868 62510923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62511524 62511612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62511702 62511785 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62511887 62512022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62512871 62512967 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62513532 62513582 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 62514074 62514186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (993 nt):
ATGCACCACCAGTCTGTTCTGCACAGCGGCTACTTTCACCCACTGCTTCGGAGCTGGCAGACTGCTGCCT
CC
ACCGTCAGTGCCTCCAACCTCATCTATCCCATCTTTGTCACGGATGTTCCTGATGATGTCCAGCCTAT
C
GCCAGCCTCCCAGGAGTGGCCAGGTATGGCGTAAACCAGCTAGAAGAGATGCTGAGACCTCTGGTGGAA
GCT
GGCCTGCGCTGTGTCCTGATCTTTGGCGTCCCCAGCAGAGTTCCCAAGGATGAACAGGGCTCTGCAG
CT
GACTCTGAGGACTCCCCAACTATTGAGGCTGTCCGTCTGCTGAGGAAGACCTTCCCTTCCCTCCTAGT
G
GCCTGTGACGTCTGCTTGTGCCCCTACACCTCCCATGGCCACTGTGGCCTCCTGAGTGAAAATGGAGCA
TTC
CTAGCAGAGGAGAGCCGACAGCGGTTGGCAGAGGTGGCACTGGCCTATGCCAAGGCAGGCTGTCAGG
TT
GTAGCTCCGTCAGACATGATGGACGGACGAGTTGAGGCCATCAAGGCTGCCCTGCTAAAACATGGACT
T
GGCAACAGGGTCTCTGTGATGAGCTATAGTGCCAAATTTGCCTCCTGTTTCTACGGTCCTTTCCGGGAT
GCA
GCTCAGTCAAGCCCAGCTTTTGGAGACCGACGCTGTTATCAGCTGCCTCCTGGTGCCCGTGGCCTGG
CC
CTCCGAGCAGTGGCCCGAGACATTCAAGAAGGAGCTGACATGCTCATGGTGAAGCCGGGATTGCCCTA
C
CTGGACATGGTGCGAGAGGTGAAGGACAAGCACCCCGAGCTCCCCCTCGCAGTATACCAGGTGTCTGGA
GAG
TTTGCCATGTTGTGGCACGGAGCCCAGGCCGGGGCCTTTGATCTCAGGACTGCTGTACTGGAGACCA
TG
ACGGCCTTCCGCAGAGCCGGTGCCGACATCATCATCACCTACTTTGCACCGCAGCTGTTGAAGTGGCT
G
AAGGAAGAATGA


Translation (330 aa):
MHHQSVLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVE
A
GLRCVLIFGVPSRVPK
DEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGA
F
LAEESRQRLAEVALAYAKA
GCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRD
A
AQSSPAFGDRRCYQLPPGARGLALRAV
ARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSG
E
FAMLWHGAQAGAFDLRTAVLETMTAFRRA
GADIIITYFAPQLLKWLKEE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser