NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17683.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17683.1 Public Mus musculus 3 Atp1a1 16 104 75 CCDS HistoryNCBI Gene:11928Re-query CCDS DB by CCDS ID:17683.1Re-query CCDS DB by GeneID:11928

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17683.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036493 ENSMUSP00000039657 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036493Link to Ensembl Protein Viewer:ENSMUSP00000039657Re-query CCDS DB by Nucleotide ID:ENSMUST00000036493Re-query CCDS DB by Protein ID:ENSMUSP00000039657
Original member Current member EBI,WTSI OTTMUST00000039619 OTTMUSP00000017686 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039619Link to Vega Protein Viewer:OTTMUSP00000017686Re-query CCDS DB by Nucleotide ID:OTTMUST00000039619Re-query CCDS DB by Protein ID:OTTMUSP00000017686
Original member Current member NCBI NM_144900.2 NP_659149.1 Accepted alive Link to Nucleotide Sequence:NM_144900.2Link to Protein Sequence:NP_659149.1Re-query CCDS DB by Nucleotide ID:NM_144900Re-query CCDS DB by Protein ID:NP_659149Link to BLink:NP_659149.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_659149.1 1023 Q8VDN2 1023 100% 0 0

Chromosomal Locations for CCDS 17683.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 101576556 101576584 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101576919 101577010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101578994 101579095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101579521 101579651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101579774 101579919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101581147 101581270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101581725 101581879 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101582002 101582170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101582688 101582838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101583745 101583881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101584723 101584898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101586127 101586319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101586816 101586950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101589006 101589115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101589767 101589965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101590447 101590715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101591121 101591238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101591340 101591474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101591781 101591894 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101592378 101592581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101594203 101594262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101594998 101595108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101604403 101604414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3072 nt):
ATGGGGAAGGGGGTTGGACGAGACAAGTATGAGCCTGCCGCTGTATCGGAGCATGGTGACAAAAAGGGCA
AA
AAGGCCAAGAAGGAAAGGGATATGGATGAGCTCAAGAAGGAAGTGTCTATGGACGACCATAAACTCAG
C
CTGGATGAACTCCATCGTAAATACGGAACAGATTTGAGCCGAGGATTAACACCTGCAAGGGCCGCTGAG
ATC
CTGGCCCGGGATGGCCCCAACGCCCTCACACCCCCTCCCACTACTCCCGAATGGGTGAAATTCTGCC
GG
CAGCTCTTTGGAGGCTTTTCCATGTTACTGTGGATCGGGGCCATTCTTTGTTTCCTGGCTTATGGCAT
C
CGAAGTGCTACAGAAGAGGAACCGCCAAACGATGATCTGTACCTCGGGGTGGTGCTCTCTGCTGTAGTC
ATC
ATAACTGGCTGTTTCTCCTATTATCAAGAAGCAAAAAGCTCCAAGATCATGGAATCCTTCAAGAACA
TG
GTCCCTCAGCAAGCCCTTGTGATTCGAAATGGAGAGAAAATGAGCATCAATGCGGAGGATGTCGTCGT
C
GGGGATCTGGTGGAGGTGAAAGGGGGAGACCGGATCCCTGCTGATCTTAGAATCATATCTGCAAACGGC
TGC
AAGGTGGATAACTCCTCACTCACTGGTGAATCAGAACCCCAGACTCGGTCCCCGGATTTCACAAACG
AG
AACCCCTTGGAGACAAGGAACATTGCCTTCTTCTCAACCAACTGTGTGGAAGGAACCGCACGTGGCAT
C
GTCGTGTACACTGGGGACCGCACCGTGATGGGCAGGATTGCCACGCTTGCCTCTGGGCTAGAAGGTGGC
CAG
ACCCCCATTGCTGAAGAGATTGAGCATTTCATCCACCTCATCACCGGGGTGGCCGTGTTCCTGGGGG
TG
TCTTTCTTCATCCTTTCTCTGATCCTTGAGTACACCTGGCTCGAGGCTGTCATCTTCCTCATTGGTAT
C
ATCGTAGCCAACGTGCCAGAAGGTCTGCTGGCCACTGTCACGGTCTGTCTGACACTCACTGCCAAGCGC
ATG
GCGAGGAAGAACTGCCTGGTGAAGAACTTGGAAGCTGTGGAGACCTTGGGGTCCACATCTACCATCT
GC
TCAGACAAGACGGGAACTCTGACTCAGAACCGGATGACAGTGGCCCACATGTGGTTTGACAATCAGAT
C
CATGAAGCTGACACCACGGAGAATCAGAGTGGTGTCTCCTTTGACAAGACGTCAGCCACCTGGTTCGCT
CTG
TCCAGAATTGCTGGTCTCTGTAACAGGGCAGTGTTTCAGGCTAACCAAGAAAACCTGCCTATTCTTA
AG
CGGGCAGTAGCGGGAGATGCCTCTGAGTCGGCGCTCTTAAAGTGCATTGAAGTCTGCTGCGGCTCCGT
G
ATGGAGATGAGGGAGAAATACAGCAAGATAGTGGAGATTCCCTTCAACTCCACCAACAAGTACCAGTTG
TCC
ATTCACAAGAACCCAAATGCATCTGAGCCCAAACACCTGCTAGTGATGAAGGGCGCCCCAGAAAGGA
TC
CTGGACCGCTGCAGCTCCATCCTTCTCCACGGCAAGGAGCAGCCACTGGATGAAGAGCTGAAGGACGC
T
TTTCAGAACGCCTACCTAGAGCTGGGGGGCCTTGGAGAACGTGTGCTAGGTTTCTGCCACCTCCTCCTG
CCT
GACGAACAGTTTCCCGAAGGCTTCCAGTTTGACACTGACGATGTCAATTTCCCCGTGGATAACCTCT
GC
TTCGTGGGTCTTATCTCCATGATTGACCCTCCCCGAGCTGCTGTCCCCGATGCTGTGGGCAAATGCCG
C
AGCGCTGGGATTAAGGTCATCATGGTTACAGGAGACCATCCAATCACAGCGAAAGCCATTGCCAAGGGG
GTA
GGCATTATCTCAGAAGGCAATGAGACTGTGGAAGACATTGCTGCCCGCCTCAACATTCCAGTGAACC
AG
GTGAACCCCAGAGATGCCAAGGCCTGTGTGGTCCACGGCAGTGACCTGAAGGACATGACCTCCGAGGA
G
CTGGATGACATCTTGCGGTACCACACAGAGATCGTCTTTGCCAGGACCTCTCCTCAGCAGAAGCTCATC
ATT
GTGGAGGGCTGCCAGCGGCAGGGCGCCATCGTGGCCGTCACAGGGGATGGTGTCAATGACTCTCCAG
CT
TTGAAAAAGGCAGATATTGGGGTTGCCATGGGGATTGTTGGCTCTGATGTGTCCAAGCAAGCTGCTGA
C
ATGATCCTTCTGGATGACAACTTTGCCTCCATTGTGACTGGAGTAGAGGAAGGTCGTCTGATTTTTGAT
AAC
TTGAAGAAATCCATCGCTTACACCCTAACCAGTAACATTCCGGAAATCACCCCCTTCTTGATATTTA
TT
ATTGCAAACATTCCACTGCCCCTGGGGACTGTGACCATCCTCTGCATTGACTTGGGCACTGACATGGT
T
CCTGCCATCTCCCTGGCCTACGAGCAAGCTGAGAGCGACATCATGAAGAGGCAGCCCAGAAACCCCAAA
ACG
GACAAACTTGTGAACGAGCGTCTGATCAGCATGGCCTATGGACAGATCGGTATGATCCAGGCCCTGG
GA
GGCTTCTTCACTTACTTTGTGATTCTGGCTGAGAACGGTTTCCTGCCCTTTCACCTGTTGGGCATCCG
A
GAGACCTGGGATGACCGCTGGGTCAACGATGTGGAGGACAGCTACGGGCAGCAGTGGACCTACGAGCAG
AGG
AAGATCGTGGAGTTCACCTGCCATACAGCGTTCTTTGTCAGTATTGTGGTAGTGCAGTGGGCCGACT
TG
GTCATCTGCAAGACCAGAAGGAATTCTGTCTTCCAGCAGGGAATGAAGAACAAGATCTTGATATTTGG
C
CTCTTTGAAGAGACAGCCCTTGCTGCTTTCTTATCCTACTGCCCCGGGATGGGGGCAGCCCTTAGGATG
TAT
CCCCTCAAACCTACATGGTGGTTCTGTGCCTTCCCCTACTCCCTTCTCATCTTTGTGTATGACGAGG
TG
CGGAAGCTCATTATCAGGCGGCGCCCTGGCGGCTGGGTGGAGAAGGAAACCTACTACTAG


Translation (1023 aa):
MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTPARAAE
I
LARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSATEEEPPNDD
LYLGVVLSAVV
I
ITGCFSYYQEAKSSKIMESFKNMVPQ
QALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANG
C
K
VDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG
Q
TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVT
VCLTLTAKR
M
ARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQS
GVSFDKTSATWFA
L
SRIAGLCNRAVFQANQENLPILK
RAVAGDASESALLKCIEVCCGSVMEMREKYSKIVEIPFNSTNKYQL
S
IHKNPNASEPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVL
GFCHLLL
P
DEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIK
VIMVTGDHPITAKAIAKG
V
GIISEGNETVEDIAARLNIPVNQVNP
RDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLI
I
VEGCQRQ
GAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFD
N
LKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDM
VPAISLAYEQAESDIMKRQPRNPK
T
DKLVNERLISMAYGQI
GMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQ
R
KIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGM
KNKILIFGLFEETALAAFLSYCPGMGAALRM
Y
PL
KPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser